Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E3S3G9

Protein Details
Accession E3S3G9    Localization Confidence High Confidence Score 16.6
NoLS Segment(s)
PositionSequenceProtein Nature
366-388QDSEARPKKKKAKKESNDSGVSRHydrophilic
568-596IPKPNRRTYVKGRGRKVVRRNGKVDPLKTBasic
NLS Segment(s)
PositionSequence
371-379RPKKKKAKK
570-605KPNRRTYVKGRGRKVVRRNGKVDPLKTFNARGKGKK
Subcellular Location(s) nucl 17.5, cyto_nucl 13, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011545  DEAD/DEAH_box_helicase_dom  
IPR014001  Helicase_ATP-bd  
IPR001650  Helicase_C  
IPR027417  P-loop_NTPase  
IPR014014  RNA_helicase_DEAD_Q_motif  
Gene Ontology GO:0005730  C:nucleolus  
GO:0005524  F:ATP binding  
GO:0003678  F:DNA helicase activity  
GO:0033677  F:DNA/RNA helicase activity  
GO:0016787  F:hydrolase activity  
GO:0003676  F:nucleic acid binding  
GO:0003724  F:RNA helicase activity  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
KEGG pte:PTT_17014  -  
Pfam View protein in Pfam  
PF00270  DEAD  
PF00271  Helicase_C  
PROSITE View protein in PROSITE  
PS51192  HELICASE_ATP_BIND_1  
PS51194  HELICASE_CTER  
PS51195  Q_MOTIF  
CDD cd17961  DEADc_DDX56  
cd18787  SF2_C_DEAD  
Amino Acid Sequences MAKRKLNEHDVPEETSGDESQSEVSSSPRPAQPTMTATATPTTSTSKKASKEAAKNQPVAASFAELQLEPRLLRAIRDLKWASPTDIQSKAIPLALEGRDILARSGTGTGKTAAYLLPILHKTLQRKQTSLILAPTRELCLQIATVAKSLSQHCGQEIRVRNIAGKESEVVTKAALADKPEVVVATPARAWANINSSNLTISDFGILVVDEGDLINGYGFSEDMENIAREMPAGVQKIVLSATLSTDVESLGSLLCTNPVILKLADLDKDSNKVKQYVLKVAEDDKFLLIYAMFKLQLIKGKTIVFVGDVDRSYRVKLFLEQFGIKSCVLNSELPLASRTHIVECFNRNEYNILIASDETDVVGVQDSEARPKKKKAKKESNDSGVSRGIDFLNVSCVLNFDFPGTYKSYFHRIGRTARAGKSGTAISFIIPKDQYRKHKPTTFAGCEHDEEVLEKVEKHQQEGQKLENYNFDMKRLEPFRYRFGDALRSVTRIAIREARIKEIHIELAKSQKLSRYFEENPEALAHLRHDQTLNHPARIQPHLKYVPDYLLPGGKKPEDVGFVGLNIPKPNRRTYVKGRGRKVVRRNGKVDPLKTFNARGKGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.32
3 0.26
4 0.19
5 0.15
6 0.12
7 0.12
8 0.12
9 0.12
10 0.1
11 0.13
12 0.17
13 0.2
14 0.25
15 0.27
16 0.31
17 0.31
18 0.35
19 0.38
20 0.38
21 0.39
22 0.37
23 0.33
24 0.31
25 0.32
26 0.28
27 0.23
28 0.21
29 0.23
30 0.21
31 0.25
32 0.3
33 0.34
34 0.38
35 0.43
36 0.5
37 0.54
38 0.63
39 0.68
40 0.73
41 0.74
42 0.73
43 0.68
44 0.62
45 0.53
46 0.46
47 0.36
48 0.29
49 0.22
50 0.2
51 0.21
52 0.16
53 0.17
54 0.16
55 0.17
56 0.13
57 0.14
58 0.17
59 0.16
60 0.17
61 0.24
62 0.29
63 0.29
64 0.38
65 0.39
66 0.37
67 0.43
68 0.44
69 0.4
70 0.39
71 0.41
72 0.37
73 0.38
74 0.38
75 0.33
76 0.33
77 0.3
78 0.26
79 0.22
80 0.17
81 0.2
82 0.18
83 0.18
84 0.16
85 0.16
86 0.15
87 0.16
88 0.15
89 0.1
90 0.09
91 0.09
92 0.12
93 0.12
94 0.12
95 0.13
96 0.14
97 0.14
98 0.14
99 0.14
100 0.11
101 0.11
102 0.11
103 0.1
104 0.14
105 0.14
106 0.17
107 0.2
108 0.24
109 0.29
110 0.37
111 0.45
112 0.44
113 0.45
114 0.45
115 0.48
116 0.48
117 0.45
118 0.44
119 0.39
120 0.36
121 0.36
122 0.34
123 0.29
124 0.25
125 0.23
126 0.16
127 0.13
128 0.12
129 0.13
130 0.14
131 0.13
132 0.14
133 0.13
134 0.13
135 0.15
136 0.16
137 0.19
138 0.19
139 0.18
140 0.19
141 0.22
142 0.23
143 0.28
144 0.34
145 0.34
146 0.35
147 0.35
148 0.36
149 0.35
150 0.37
151 0.3
152 0.24
153 0.2
154 0.18
155 0.19
156 0.17
157 0.16
158 0.13
159 0.12
160 0.12
161 0.13
162 0.13
163 0.13
164 0.14
165 0.13
166 0.14
167 0.13
168 0.12
169 0.1
170 0.11
171 0.09
172 0.09
173 0.09
174 0.1
175 0.1
176 0.11
177 0.12
178 0.11
179 0.17
180 0.19
181 0.2
182 0.2
183 0.2
184 0.2
185 0.19
186 0.18
187 0.13
188 0.09
189 0.09
190 0.08
191 0.07
192 0.07
193 0.07
194 0.05
195 0.05
196 0.04
197 0.03
198 0.03
199 0.03
200 0.03
201 0.03
202 0.03
203 0.03
204 0.03
205 0.03
206 0.03
207 0.03
208 0.04
209 0.04
210 0.05
211 0.06
212 0.06
213 0.06
214 0.07
215 0.06
216 0.06
217 0.06
218 0.07
219 0.09
220 0.1
221 0.1
222 0.1
223 0.1
224 0.11
225 0.11
226 0.1
227 0.06
228 0.05
229 0.06
230 0.07
231 0.07
232 0.07
233 0.07
234 0.07
235 0.06
236 0.06
237 0.05
238 0.04
239 0.04
240 0.04
241 0.03
242 0.04
243 0.04
244 0.04
245 0.04
246 0.05
247 0.06
248 0.06
249 0.07
250 0.08
251 0.09
252 0.1
253 0.11
254 0.12
255 0.11
256 0.15
257 0.16
258 0.18
259 0.18
260 0.19
261 0.19
262 0.23
263 0.25
264 0.28
265 0.3
266 0.27
267 0.27
268 0.28
269 0.29
270 0.24
271 0.22
272 0.15
273 0.12
274 0.11
275 0.1
276 0.06
277 0.06
278 0.05
279 0.06
280 0.06
281 0.06
282 0.07
283 0.08
284 0.13
285 0.14
286 0.14
287 0.15
288 0.16
289 0.16
290 0.15
291 0.14
292 0.1
293 0.09
294 0.09
295 0.09
296 0.08
297 0.09
298 0.1
299 0.11
300 0.11
301 0.11
302 0.11
303 0.1
304 0.14
305 0.16
306 0.17
307 0.2
308 0.2
309 0.19
310 0.2
311 0.21
312 0.17
313 0.15
314 0.12
315 0.11
316 0.12
317 0.12
318 0.11
319 0.13
320 0.13
321 0.13
322 0.14
323 0.13
324 0.11
325 0.13
326 0.13
327 0.1
328 0.12
329 0.14
330 0.16
331 0.19
332 0.22
333 0.24
334 0.23
335 0.22
336 0.22
337 0.2
338 0.18
339 0.15
340 0.11
341 0.09
342 0.08
343 0.09
344 0.08
345 0.08
346 0.05
347 0.05
348 0.04
349 0.04
350 0.05
351 0.03
352 0.03
353 0.06
354 0.06
355 0.14
356 0.2
357 0.24
358 0.28
359 0.37
360 0.47
361 0.52
362 0.63
363 0.67
364 0.72
365 0.78
366 0.85
367 0.86
368 0.83
369 0.82
370 0.73
371 0.64
372 0.55
373 0.46
374 0.35
375 0.27
376 0.19
377 0.12
378 0.12
379 0.09
380 0.1
381 0.1
382 0.1
383 0.08
384 0.09
385 0.09
386 0.1
387 0.1
388 0.08
389 0.07
390 0.08
391 0.11
392 0.13
393 0.14
394 0.15
395 0.17
396 0.23
397 0.27
398 0.29
399 0.33
400 0.35
401 0.39
402 0.44
403 0.51
404 0.5
405 0.46
406 0.49
407 0.44
408 0.39
409 0.36
410 0.31
411 0.23
412 0.19
413 0.18
414 0.13
415 0.16
416 0.16
417 0.17
418 0.16
419 0.18
420 0.24
421 0.31
422 0.41
423 0.47
424 0.55
425 0.6
426 0.65
427 0.68
428 0.7
429 0.72
430 0.68
431 0.62
432 0.58
433 0.52
434 0.47
435 0.43
436 0.34
437 0.24
438 0.19
439 0.17
440 0.15
441 0.13
442 0.11
443 0.13
444 0.19
445 0.2
446 0.23
447 0.28
448 0.3
449 0.37
450 0.4
451 0.42
452 0.42
453 0.44
454 0.42
455 0.4
456 0.39
457 0.39
458 0.36
459 0.33
460 0.28
461 0.27
462 0.34
463 0.32
464 0.34
465 0.34
466 0.37
467 0.43
468 0.46
469 0.48
470 0.41
471 0.42
472 0.45
473 0.38
474 0.41
475 0.36
476 0.32
477 0.3
478 0.3
479 0.3
480 0.23
481 0.26
482 0.26
483 0.28
484 0.34
485 0.35
486 0.39
487 0.37
488 0.37
489 0.36
490 0.32
491 0.35
492 0.29
493 0.28
494 0.25
495 0.32
496 0.33
497 0.31
498 0.3
499 0.31
500 0.34
501 0.37
502 0.39
503 0.4
504 0.42
505 0.47
506 0.52
507 0.46
508 0.42
509 0.38
510 0.35
511 0.27
512 0.25
513 0.2
514 0.19
515 0.2
516 0.21
517 0.21
518 0.21
519 0.27
520 0.36
521 0.38
522 0.35
523 0.36
524 0.36
525 0.4
526 0.46
527 0.44
528 0.37
529 0.43
530 0.46
531 0.46
532 0.47
533 0.44
534 0.41
535 0.38
536 0.36
537 0.29
538 0.29
539 0.28
540 0.28
541 0.31
542 0.28
543 0.27
544 0.28
545 0.29
546 0.26
547 0.27
548 0.27
549 0.22
550 0.22
551 0.24
552 0.24
553 0.23
554 0.24
555 0.28
556 0.31
557 0.34
558 0.4
559 0.44
560 0.48
561 0.54
562 0.6
563 0.67
564 0.71
565 0.77
566 0.77
567 0.8
568 0.83
569 0.84
570 0.84
571 0.84
572 0.84
573 0.84
574 0.83
575 0.81
576 0.82
577 0.81
578 0.76
579 0.73
580 0.69
581 0.65
582 0.64
583 0.62
584 0.59
585 0.59