Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3RDD7

Protein Details
Accession E3RDD7    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MARNRYSQTRKNDRKPLRIFQANHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036691  Endo/exonu/phosph_ase_sf  
KEGG pte:PTT_02047  -  
Amino Acid Sequences MARNRYSQTRKNDRKPLRIFQANVGKIPPAHDCALALADSEQYDVVLLQEPWTAHTETRTLTKTHPAYDTFTP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.86
3 0.84
4 0.82
5 0.79
6 0.71
7 0.68
8 0.69
9 0.6
10 0.53
11 0.45
12 0.36
13 0.28
14 0.29
15 0.22
16 0.15
17 0.15
18 0.14
19 0.13
20 0.13
21 0.13
22 0.11
23 0.09
24 0.06
25 0.05
26 0.05
27 0.05
28 0.05
29 0.04
30 0.04
31 0.04
32 0.04
33 0.06
34 0.06
35 0.06
36 0.08
37 0.08
38 0.1
39 0.13
40 0.14
41 0.12
42 0.14
43 0.15
44 0.15
45 0.21
46 0.21
47 0.2
48 0.22
49 0.31
50 0.33
51 0.35
52 0.38
53 0.34