Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W7MAB1

Protein Details
Accession W7MAB1   
Localization Confidence Medium
Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
62-95SNWNRTKKEEVGRRKKENLRSQRRRFRFEVRPERBasic
NLS Segment(s)
PositionSequence
68-95KKEEVGRRKKENLRSQRRRFRFEVRPER
Subcellular Location(s) nucl 16, mito 7, cyto 4
Family & Domain DBs
KEGG fvr:FVEG_16209  -  
Amino Acid Sequences MASKSYWGNGPDNTAATGLKVVEMNRGKLGGRTTRMADVKTMVCKEKEWTAKTSATLQKQESNWNRTKKEEVGRRKKENLRSQRRRFRFEVRPER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.19
3 0.16
4 0.16
5 0.11
6 0.1
7 0.1
8 0.1
9 0.17
10 0.2
11 0.21
12 0.2
13 0.21
14 0.21
15 0.21
16 0.26
17 0.23
18 0.24
19 0.24
20 0.25
21 0.3
22 0.31
23 0.29
24 0.26
25 0.23
26 0.22
27 0.23
28 0.23
29 0.19
30 0.18
31 0.18
32 0.19
33 0.23
34 0.27
35 0.26
36 0.27
37 0.29
38 0.29
39 0.3
40 0.35
41 0.34
42 0.32
43 0.34
44 0.33
45 0.34
46 0.35
47 0.43
48 0.43
49 0.45
50 0.48
51 0.52
52 0.53
53 0.51
54 0.55
55 0.52
56 0.55
57 0.57
58 0.61
59 0.65
60 0.72
61 0.76
62 0.81
63 0.82
64 0.82
65 0.83
66 0.83
67 0.84
68 0.85
69 0.89
70 0.9
71 0.9
72 0.88
73 0.83
74 0.82
75 0.8