Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W7LNH1

Protein Details
Accession W7LNH1    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
68-99QRRATRKRVKAGEDRKRRRRRVGEGQHSQELDBasic
NLS Segment(s)
PositionSequence
58-88RRRRAPVFSAQRRATRKRVKAGEDRKRRRRR
Subcellular Location(s) nucl 7, cyto 5, plas 5, mito 4, E.R. 3, cyto_pero 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG fvr:FVEG_14733  -  
Amino Acid Sequences MNQAIAAAAAMSVVMIMMIGSERRRERIRPLPTTDENNNIRMDTKEGPEQHELEIMQRRRRAPVFSAQRRATRKRVKAGEDRKRRRRRVGEGQHSQELDGQTAAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.02
2 0.02
3 0.02
4 0.02
5 0.03
6 0.05
7 0.06
8 0.12
9 0.14
10 0.2
11 0.24
12 0.26
13 0.35
14 0.43
15 0.51
16 0.52
17 0.57
18 0.59
19 0.6
20 0.63
21 0.57
22 0.55
23 0.48
24 0.43
25 0.37
26 0.3
27 0.27
28 0.22
29 0.23
30 0.17
31 0.17
32 0.2
33 0.2
34 0.24
35 0.25
36 0.25
37 0.22
38 0.21
39 0.19
40 0.17
41 0.23
42 0.23
43 0.25
44 0.28
45 0.29
46 0.32
47 0.34
48 0.34
49 0.3
50 0.36
51 0.42
52 0.47
53 0.55
54 0.54
55 0.59
56 0.63
57 0.66
58 0.66
59 0.65
60 0.65
61 0.66
62 0.69
63 0.69
64 0.73
65 0.78
66 0.78
67 0.8
68 0.83
69 0.85
70 0.89
71 0.9
72 0.9
73 0.89
74 0.88
75 0.88
76 0.89
77 0.89
78 0.88
79 0.86
80 0.81
81 0.72
82 0.62
83 0.55
84 0.44
85 0.35