Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W7N6E8

Protein Details
Accession W7N6E8    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
46-69PMMLTSFKPRRRRRTPSSIRDYVAHydrophilic
NLS Segment(s)
PositionSequence
55-58RRRR
Subcellular Location(s) nucl 21, cyto_nucl 13, mito 3, cyto 3
Family & Domain DBs
KEGG fvr:FVEG_10992  -  
Amino Acid Sequences MPPLRYRTDCPHEPDDVLNVRSGGLNKPRSIATQIPASWLPRAFIPMMLTSFKPRRRRRTPSSIRDYVASTAKH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.41
3 0.37
4 0.32
5 0.26
6 0.21
7 0.19
8 0.19
9 0.19
10 0.18
11 0.22
12 0.25
13 0.24
14 0.26
15 0.26
16 0.27
17 0.3
18 0.27
19 0.21
20 0.22
21 0.22
22 0.23
23 0.23
24 0.22
25 0.2
26 0.18
27 0.16
28 0.11
29 0.13
30 0.11
31 0.11
32 0.11
33 0.11
34 0.12
35 0.14
36 0.14
37 0.19
38 0.26
39 0.33
40 0.42
41 0.5
42 0.59
43 0.68
44 0.77
45 0.8
46 0.84
47 0.88
48 0.88
49 0.88
50 0.84
51 0.75
52 0.68
53 0.61
54 0.53