Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W7MZ56

Protein Details
Accession W7MZ56   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
49-74WLMFKIRKIKNKLKIRRRLKKDAAAAHydrophilic
NLS Segment(s)
PositionSequence
37-69RKPRPRPLTRSAWLMFKIRKIKNKLKIRRRLKK
Subcellular Location(s) mito 19, extr 4, cyto 2
Family & Domain DBs
KEGG fvr:FVEG_11592  -  
Amino Acid Sequences MARGSGPRLAAIVPGKLELYPHTGSAGSTLVAAVAARKPRPRPLTRSAWLMFKIRKIKNKLKIRRRLKKDAAAAANVTHEVIGLVSLERVCKNIQGLCRRCARDEHLGCQHGQHVCAARPPWCRPRSPPEFLRSQPPAGQPLRGSWRCWYAISIERSASALHLAVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.16
4 0.17
5 0.14
6 0.18
7 0.16
8 0.16
9 0.16
10 0.16
11 0.16
12 0.17
13 0.15
14 0.09
15 0.08
16 0.08
17 0.06
18 0.06
19 0.06
20 0.06
21 0.09
22 0.14
23 0.17
24 0.23
25 0.27
26 0.36
27 0.46
28 0.51
29 0.55
30 0.58
31 0.64
32 0.62
33 0.66
34 0.58
35 0.53
36 0.49
37 0.47
38 0.42
39 0.39
40 0.45
41 0.43
42 0.5
43 0.54
44 0.61
45 0.65
46 0.74
47 0.77
48 0.78
49 0.83
50 0.86
51 0.88
52 0.87
53 0.87
54 0.84
55 0.82
56 0.77
57 0.74
58 0.65
59 0.56
60 0.47
61 0.37
62 0.3
63 0.22
64 0.16
65 0.08
66 0.06
67 0.04
68 0.04
69 0.03
70 0.03
71 0.03
72 0.03
73 0.04
74 0.05
75 0.05
76 0.06
77 0.06
78 0.07
79 0.09
80 0.12
81 0.18
82 0.27
83 0.3
84 0.34
85 0.41
86 0.41
87 0.41
88 0.42
89 0.41
90 0.42
91 0.41
92 0.42
93 0.42
94 0.42
95 0.41
96 0.38
97 0.37
98 0.27
99 0.25
100 0.21
101 0.17
102 0.16
103 0.21
104 0.22
105 0.23
106 0.29
107 0.35
108 0.42
109 0.43
110 0.47
111 0.49
112 0.57
113 0.6
114 0.61
115 0.62
116 0.57
117 0.61
118 0.58
119 0.61
120 0.55
121 0.5
122 0.47
123 0.43
124 0.45
125 0.39
126 0.41
127 0.33
128 0.35
129 0.42
130 0.4
131 0.4
132 0.36
133 0.41
134 0.39
135 0.39
136 0.34
137 0.29
138 0.35
139 0.37
140 0.36
141 0.31
142 0.29
143 0.29
144 0.28
145 0.23
146 0.17