Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W7M5G7

Protein Details
Accession W7M5G7   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
94-128LVQKRRHGFLCRKRSKTGRKILLRRKIKGRRHIAQBasic
NLS Segment(s)
PositionSequence
103-126LCRKRSKTGRKILLRRKIKGRRHI
Subcellular Location(s) mito 22, mito_nucl 13.666, cyto_mito 12.166, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG fvr:FVEG_04528  -  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MNTVFSSITRLARPVLAKTLAQSPRTFTTLVPLRPSLTPMTGAIRRTALPSSFTPSTAASADIVPSGAISAHPALGDMQIRCGPRNTMNGHTRLVQKRRHGFLCRKRSKTGRKILLRRKIKGRRHIAQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.27
3 0.26
4 0.25
5 0.26
6 0.34
7 0.35
8 0.35
9 0.33
10 0.32
11 0.33
12 0.35
13 0.33
14 0.24
15 0.27
16 0.32
17 0.33
18 0.33
19 0.3
20 0.3
21 0.3
22 0.32
23 0.25
24 0.19
25 0.18
26 0.15
27 0.19
28 0.2
29 0.2
30 0.19
31 0.19
32 0.18
33 0.19
34 0.2
35 0.15
36 0.15
37 0.16
38 0.21
39 0.2
40 0.2
41 0.19
42 0.18
43 0.18
44 0.15
45 0.15
46 0.09
47 0.09
48 0.08
49 0.07
50 0.07
51 0.05
52 0.04
53 0.04
54 0.03
55 0.03
56 0.04
57 0.04
58 0.04
59 0.04
60 0.05
61 0.05
62 0.06
63 0.09
64 0.08
65 0.1
66 0.13
67 0.14
68 0.15
69 0.16
70 0.17
71 0.18
72 0.25
73 0.27
74 0.31
75 0.36
76 0.38
77 0.38
78 0.39
79 0.44
80 0.46
81 0.5
82 0.48
83 0.53
84 0.58
85 0.63
86 0.67
87 0.67
88 0.69
89 0.73
90 0.77
91 0.78
92 0.75
93 0.77
94 0.8
95 0.83
96 0.82
97 0.83
98 0.82
99 0.82
100 0.88
101 0.9
102 0.9
103 0.89
104 0.86
105 0.86
106 0.86
107 0.85
108 0.85