Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W7MRK6

Protein Details
Accession W7MRK6   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
283-311RFTEKVQKEESRRQRRIDRKENKNLYAYWHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR041661  ZN622/Rei1/Reh1_Znf-C2H2  
IPR040025  Znf622/Rei1/Reh1  
KEGG fvr:FVEG_12389  -  
Pfam View protein in Pfam  
PF12756  zf-C2H2_2  
Amino Acid Sequences MLGATATTTATTTTSMPLLSSEEISPLTPYIMSINDFAPAPQSFTPGQCLFCPSVYPTLAESIIHMQTSHGLFVPYKQHLLVDLETLFRYLHLVIYGYRECIHCGTSRTTVQAVQQHMMGKGHCKFDVSEGSEFADFYDFSRQDLDTEDDFLSEDDEDEFEGAEPKLDRKPLQVDRDSIRLPSGRLISKKLSAQVEPSVSQIRERKRTSRSQLEYSSVEAGDEGPMHEESVPETSDTRVLSRRERRQKATVTHQLANMSAGDRSALMHLSASEQRSFIATQHRFTEKVQKEESRRQRRIDRKENKNLYAYWHTETPVYQCG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.11
4 0.12
5 0.14
6 0.14
7 0.15
8 0.14
9 0.14
10 0.15
11 0.15
12 0.15
13 0.13
14 0.12
15 0.1
16 0.1
17 0.1
18 0.11
19 0.12
20 0.13
21 0.13
22 0.13
23 0.13
24 0.13
25 0.15
26 0.14
27 0.16
28 0.15
29 0.18
30 0.18
31 0.2
32 0.27
33 0.25
34 0.26
35 0.23
36 0.27
37 0.25
38 0.24
39 0.25
40 0.2
41 0.23
42 0.22
43 0.22
44 0.19
45 0.2
46 0.2
47 0.18
48 0.17
49 0.16
50 0.16
51 0.15
52 0.14
53 0.12
54 0.15
55 0.16
56 0.15
57 0.12
58 0.12
59 0.12
60 0.15
61 0.22
62 0.19
63 0.2
64 0.19
65 0.19
66 0.2
67 0.23
68 0.2
69 0.16
70 0.15
71 0.15
72 0.15
73 0.15
74 0.13
75 0.09
76 0.1
77 0.08
78 0.08
79 0.07
80 0.08
81 0.08
82 0.13
83 0.14
84 0.13
85 0.15
86 0.14
87 0.15
88 0.16
89 0.17
90 0.14
91 0.17
92 0.2
93 0.23
94 0.23
95 0.24
96 0.24
97 0.24
98 0.25
99 0.27
100 0.25
101 0.22
102 0.23
103 0.22
104 0.22
105 0.22
106 0.18
107 0.19
108 0.2
109 0.22
110 0.2
111 0.19
112 0.18
113 0.21
114 0.27
115 0.25
116 0.22
117 0.2
118 0.21
119 0.2
120 0.2
121 0.16
122 0.11
123 0.07
124 0.07
125 0.14
126 0.13
127 0.13
128 0.15
129 0.14
130 0.14
131 0.16
132 0.18
133 0.11
134 0.14
135 0.14
136 0.12
137 0.12
138 0.12
139 0.1
140 0.07
141 0.07
142 0.04
143 0.04
144 0.04
145 0.04
146 0.04
147 0.04
148 0.05
149 0.05
150 0.06
151 0.06
152 0.08
153 0.1
154 0.12
155 0.12
156 0.14
157 0.22
158 0.28
159 0.34
160 0.35
161 0.37
162 0.37
163 0.41
164 0.39
165 0.31
166 0.26
167 0.21
168 0.18
169 0.18
170 0.2
171 0.19
172 0.2
173 0.24
174 0.24
175 0.26
176 0.27
177 0.29
178 0.27
179 0.24
180 0.25
181 0.25
182 0.25
183 0.22
184 0.23
185 0.22
186 0.19
187 0.23
188 0.26
189 0.3
190 0.36
191 0.4
192 0.45
193 0.48
194 0.57
195 0.61
196 0.66
197 0.65
198 0.63
199 0.62
200 0.59
201 0.54
202 0.46
203 0.39
204 0.28
205 0.23
206 0.16
207 0.13
208 0.09
209 0.08
210 0.07
211 0.07
212 0.07
213 0.08
214 0.08
215 0.07
216 0.08
217 0.1
218 0.1
219 0.09
220 0.09
221 0.1
222 0.12
223 0.13
224 0.14
225 0.18
226 0.21
227 0.3
228 0.39
229 0.49
230 0.58
231 0.66
232 0.7
233 0.73
234 0.78
235 0.76
236 0.76
237 0.76
238 0.71
239 0.66
240 0.61
241 0.54
242 0.46
243 0.39
244 0.29
245 0.2
246 0.14
247 0.11
248 0.09
249 0.08
250 0.08
251 0.08
252 0.08
253 0.07
254 0.08
255 0.08
256 0.12
257 0.16
258 0.18
259 0.17
260 0.17
261 0.17
262 0.19
263 0.19
264 0.18
265 0.25
266 0.25
267 0.27
268 0.33
269 0.36
270 0.36
271 0.38
272 0.46
273 0.42
274 0.47
275 0.51
276 0.54
277 0.59
278 0.68
279 0.77
280 0.77
281 0.77
282 0.78
283 0.81
284 0.83
285 0.86
286 0.87
287 0.86
288 0.86
289 0.9
290 0.91
291 0.86
292 0.8
293 0.7
294 0.67
295 0.65
296 0.57
297 0.51
298 0.44
299 0.39
300 0.35
301 0.36