Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W7LTA7

Protein Details
Accession W7LTA7    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
4-34RDTYSEPPRSHRQSHRQPPPRRGPPVKQSASHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto_nucl 12, mito 4, cyto 3
Family & Domain DBs
KEGG fvr:FVEG_15429  -  
Amino Acid Sequences MGRRDTYSEPPRSHRQSHRQPPPRRGPPVKQSASGFDWTPGIVLALLGAFTWLSHDFDNYKKKHEHCDDRRGSRSRDSERGRRRYRSSSRYPDDDYDDYNYRGGRGYSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.72
3 0.74
4 0.81
5 0.85
6 0.86
7 0.88
8 0.89
9 0.9
10 0.89
11 0.87
12 0.85
13 0.82
14 0.81
15 0.82
16 0.75
17 0.68
18 0.6
19 0.55
20 0.5
21 0.43
22 0.34
23 0.24
24 0.21
25 0.17
26 0.15
27 0.1
28 0.07
29 0.05
30 0.04
31 0.03
32 0.03
33 0.03
34 0.03
35 0.03
36 0.02
37 0.02
38 0.04
39 0.05
40 0.06
41 0.06
42 0.07
43 0.09
44 0.14
45 0.22
46 0.22
47 0.26
48 0.3
49 0.32
50 0.41
51 0.48
52 0.54
53 0.54
54 0.64
55 0.67
56 0.69
57 0.76
58 0.71
59 0.66
60 0.63
61 0.63
62 0.59
63 0.61
64 0.61
65 0.63
66 0.68
67 0.76
68 0.75
69 0.75
70 0.75
71 0.76
72 0.79
73 0.78
74 0.79
75 0.79
76 0.78
77 0.76
78 0.74
79 0.67
80 0.64
81 0.57
82 0.49
83 0.45
84 0.42
85 0.37
86 0.34
87 0.3
88 0.24
89 0.24