Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W7MER1

Protein Details
Accession W7MER1    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
62-89AHKLQCASKHKTRQRKNIPKPTIRIMNLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, mito 10
Family & Domain DBs
KEGG fvr:FVEG_15922  -  
Amino Acid Sequences MTQPVFITQSQKSITQVNSVNITPFYSAIPPYKNTHAFVSNCRLPLKYTSQLTPTEDSNPAAHKLQCASKHKTRQRKNIPKPTIRIMNLTKAAGASPQLST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.3
3 0.32
4 0.3
5 0.31
6 0.29
7 0.29
8 0.24
9 0.24
10 0.18
11 0.15
12 0.13
13 0.11
14 0.13
15 0.15
16 0.17
17 0.19
18 0.22
19 0.27
20 0.29
21 0.3
22 0.3
23 0.33
24 0.32
25 0.33
26 0.37
27 0.33
28 0.32
29 0.31
30 0.29
31 0.24
32 0.27
33 0.29
34 0.27
35 0.26
36 0.25
37 0.27
38 0.28
39 0.29
40 0.27
41 0.22
42 0.19
43 0.19
44 0.18
45 0.17
46 0.17
47 0.17
48 0.17
49 0.17
50 0.15
51 0.16
52 0.2
53 0.27
54 0.32
55 0.38
56 0.44
57 0.54
58 0.62
59 0.71
60 0.75
61 0.79
62 0.84
63 0.88
64 0.9
65 0.91
66 0.92
67 0.89
68 0.85
69 0.83
70 0.8
71 0.71
72 0.67
73 0.6
74 0.58
75 0.53
76 0.48
77 0.4
78 0.31
79 0.29
80 0.23
81 0.21