Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W7MG20

Protein Details
Accession W7MG20   
Localization Confidence Medium
Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
105-128GMTALKPRDRSKKKAKAKKKKAAVBasic
NLS Segment(s)
PositionSequence
110-128KPRDRSKKKAKAKKKKAAV
Subcellular Location(s) nucl 23.5, cyto_nucl 15
Family & Domain DBs
InterPro View protein in InterPro  
IPR003210  Signal_recog_particle_SRP14  
IPR009018  Signal_recog_particle_SRP9/14  
Gene Ontology GO:0005786  C:signal recognition particle, endoplasmic reticulum targeting  
GO:0008312  F:7S RNA binding  
GO:0030942  F:endoplasmic reticulum signal peptide binding  
GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
KEGG fvr:FVEG_05077  -  
Pfam View protein in Pfam  
PF02290  SRP14  
Amino Acid Sequences MADSHMSHDEFFAKLGELFNHRKGSDHGAVYLSQKRLTYGQDIPSPSEEEPSPDIHPGKPLPLIIRATNGKGKKDRSNKAKLSTVVNPEDLEAFYVRYADVCKAGMTALKPRDRSKKKAKAKKKKAAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.13
3 0.14
4 0.19
5 0.24
6 0.29
7 0.33
8 0.32
9 0.33
10 0.34
11 0.39
12 0.39
13 0.35
14 0.3
15 0.27
16 0.28
17 0.3
18 0.33
19 0.27
20 0.23
21 0.22
22 0.22
23 0.23
24 0.24
25 0.25
26 0.23
27 0.26
28 0.29
29 0.3
30 0.3
31 0.29
32 0.29
33 0.24
34 0.22
35 0.17
36 0.16
37 0.16
38 0.17
39 0.16
40 0.17
41 0.18
42 0.16
43 0.19
44 0.16
45 0.16
46 0.15
47 0.15
48 0.13
49 0.16
50 0.17
51 0.15
52 0.18
53 0.17
54 0.19
55 0.24
56 0.24
57 0.25
58 0.28
59 0.33
60 0.38
61 0.46
62 0.53
63 0.56
64 0.64
65 0.65
66 0.65
67 0.67
68 0.6
69 0.56
70 0.53
71 0.5
72 0.42
73 0.38
74 0.32
75 0.27
76 0.25
77 0.2
78 0.16
79 0.1
80 0.09
81 0.08
82 0.08
83 0.07
84 0.07
85 0.09
86 0.09
87 0.1
88 0.1
89 0.1
90 0.1
91 0.1
92 0.12
93 0.13
94 0.2
95 0.27
96 0.32
97 0.36
98 0.44
99 0.55
100 0.6
101 0.67
102 0.71
103 0.74
104 0.79
105 0.86
106 0.9
107 0.9
108 0.94