Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W7MVS9

Protein Details
Accession W7MVS9    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
2-24LLSERRKKEHALRRKSWDRAFTTHydrophilic
NLS Segment(s)
PositionSequence
7-15RKKEHALRR
Subcellular Location(s) nucl 18.5, cyto_nucl 12, cyto 4.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001128  Cyt_P450  
IPR002401  Cyt_P450_E_grp-I  
IPR036396  Cyt_P450_sf  
Gene Ontology GO:0016020  C:membrane  
GO:0020037  F:heme binding  
GO:0005506  F:iron ion binding  
GO:0004497  F:monooxygenase activity  
GO:0016705  F:oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen  
KEGG fvr:FVEG_16863  -  
Pfam View protein in Pfam  
PF00067  p450  
CDD cd11061  CYP67-like  
Amino Acid Sequences MLLSERRKKEHALRRKSWDRAFTTKALRDYEHRVLKYTKLLNDRIDEAKGEPFNIALWVNFYTFDIMGDLAFGKSFDMLESGVEHNFFTESHKTQGFMGAFRRLVWFFPLVSSIPIVNSSFLAFQAYIRNQVETRRKNKPAEPDVFSSILEDYDAMEKPTQQDFDNLCGDAHLIVIAGSDTTSSSTTCLLHNLVLHPDVLAKLQAEIDEYKNTHDEYDLVSLSKLQYLQACIDESLRLYPVVPSGVPRMTPPEGMQLDGVYIPGDTIIHSPSYTMYRDERCFEKPNEFIPERWTTKPELIKDASAYAPFHTGRGVCAGKQLGLMEMRYVLMDILSRYDIAFTPGTNPQAFIDGLRDCYTLELPRLDMVFTPRTGGNAKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.85
3 0.87
4 0.84
5 0.82
6 0.79
7 0.76
8 0.73
9 0.69
10 0.69
11 0.65
12 0.63
13 0.58
14 0.53
15 0.5
16 0.52
17 0.55
18 0.55
19 0.5
20 0.49
21 0.48
22 0.49
23 0.53
24 0.51
25 0.48
26 0.47
27 0.51
28 0.51
29 0.52
30 0.52
31 0.46
32 0.41
33 0.36
34 0.3
35 0.32
36 0.28
37 0.25
38 0.21
39 0.18
40 0.17
41 0.17
42 0.16
43 0.09
44 0.11
45 0.11
46 0.12
47 0.12
48 0.12
49 0.12
50 0.11
51 0.12
52 0.1
53 0.08
54 0.08
55 0.08
56 0.08
57 0.06
58 0.06
59 0.06
60 0.05
61 0.06
62 0.06
63 0.06
64 0.06
65 0.06
66 0.06
67 0.09
68 0.1
69 0.1
70 0.11
71 0.1
72 0.1
73 0.1
74 0.1
75 0.12
76 0.16
77 0.18
78 0.21
79 0.22
80 0.22
81 0.22
82 0.28
83 0.25
84 0.22
85 0.23
86 0.24
87 0.24
88 0.24
89 0.27
90 0.21
91 0.21
92 0.21
93 0.18
94 0.14
95 0.14
96 0.15
97 0.13
98 0.13
99 0.13
100 0.11
101 0.09
102 0.11
103 0.11
104 0.09
105 0.09
106 0.09
107 0.08
108 0.08
109 0.09
110 0.08
111 0.08
112 0.14
113 0.15
114 0.2
115 0.2
116 0.21
117 0.21
118 0.29
119 0.38
120 0.4
121 0.46
122 0.5
123 0.56
124 0.59
125 0.64
126 0.66
127 0.65
128 0.62
129 0.6
130 0.54
131 0.51
132 0.46
133 0.41
134 0.32
135 0.23
136 0.17
137 0.12
138 0.09
139 0.06
140 0.08
141 0.08
142 0.08
143 0.08
144 0.09
145 0.11
146 0.13
147 0.14
148 0.12
149 0.18
150 0.18
151 0.21
152 0.22
153 0.2
154 0.18
155 0.16
156 0.16
157 0.1
158 0.09
159 0.05
160 0.03
161 0.03
162 0.03
163 0.03
164 0.03
165 0.02
166 0.03
167 0.03
168 0.04
169 0.04
170 0.04
171 0.05
172 0.06
173 0.07
174 0.07
175 0.09
176 0.08
177 0.09
178 0.1
179 0.1
180 0.1
181 0.1
182 0.09
183 0.08
184 0.08
185 0.07
186 0.07
187 0.06
188 0.05
189 0.05
190 0.06
191 0.06
192 0.07
193 0.08
194 0.09
195 0.11
196 0.11
197 0.12
198 0.13
199 0.13
200 0.12
201 0.11
202 0.1
203 0.09
204 0.12
205 0.11
206 0.1
207 0.1
208 0.1
209 0.1
210 0.11
211 0.09
212 0.08
213 0.09
214 0.1
215 0.11
216 0.12
217 0.12
218 0.11
219 0.12
220 0.11
221 0.1
222 0.1
223 0.09
224 0.08
225 0.07
226 0.07
227 0.08
228 0.08
229 0.08
230 0.09
231 0.11
232 0.12
233 0.12
234 0.12
235 0.17
236 0.17
237 0.18
238 0.18
239 0.22
240 0.22
241 0.22
242 0.22
243 0.16
244 0.16
245 0.15
246 0.14
247 0.06
248 0.05
249 0.04
250 0.04
251 0.04
252 0.04
253 0.05
254 0.06
255 0.07
256 0.07
257 0.07
258 0.09
259 0.12
260 0.12
261 0.14
262 0.18
263 0.24
264 0.26
265 0.29
266 0.31
267 0.34
268 0.39
269 0.39
270 0.41
271 0.37
272 0.4
273 0.45
274 0.43
275 0.39
276 0.38
277 0.44
278 0.41
279 0.41
280 0.39
281 0.34
282 0.39
283 0.44
284 0.41
285 0.4
286 0.38
287 0.37
288 0.36
289 0.35
290 0.3
291 0.26
292 0.24
293 0.17
294 0.2
295 0.19
296 0.18
297 0.18
298 0.16
299 0.15
300 0.21
301 0.22
302 0.17
303 0.22
304 0.23
305 0.21
306 0.22
307 0.22
308 0.18
309 0.18
310 0.18
311 0.14
312 0.13
313 0.13
314 0.11
315 0.11
316 0.08
317 0.07
318 0.08
319 0.07
320 0.09
321 0.1
322 0.1
323 0.1
324 0.12
325 0.11
326 0.14
327 0.14
328 0.12
329 0.16
330 0.2
331 0.24
332 0.22
333 0.23
334 0.2
335 0.23
336 0.22
337 0.19
338 0.19
339 0.17
340 0.2
341 0.21
342 0.21
343 0.18
344 0.2
345 0.22
346 0.21
347 0.23
348 0.22
349 0.21
350 0.23
351 0.24
352 0.22
353 0.21
354 0.23
355 0.24
356 0.23
357 0.25
358 0.22
359 0.25