Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W7MVM8

Protein Details
Accession W7MVM8    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
56-75TEDARGRRRLKKPLNIGVKFHydrophilic
NLS Segment(s)
PositionSequence
63-64RR
Subcellular Location(s) nucl 17, mito 5, cyto 4
Family & Domain DBs
KEGG fvr:FVEG_13333  -  
Amino Acid Sequences MRFELRDWRCKRVVSPQKTESLPRDQVIDLHRDICFITSDSWEYLLRPWKPIYLQTEDARGRRRLKKPLNIGVKFDPSWAEEMQKAVETTYFATVLRDLPPPMAFAVRLLFQVATDDRYSLSKSKVMLIDDVSEWQSFDTEGHGGCRIFDSGQEYVEMGCLLGFSTHIPLPDSPMDDFIEDLNYLFMGRLQEACQSNRRTHILDTDFLLPVLRREKQVPMVRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.65
3 0.63
4 0.65
5 0.65
6 0.67
7 0.61
8 0.6
9 0.55
10 0.46
11 0.44
12 0.37
13 0.39
14 0.36
15 0.36
16 0.28
17 0.26
18 0.25
19 0.23
20 0.22
21 0.19
22 0.17
23 0.13
24 0.13
25 0.13
26 0.15
27 0.15
28 0.17
29 0.16
30 0.15
31 0.19
32 0.25
33 0.24
34 0.26
35 0.26
36 0.28
37 0.29
38 0.34
39 0.35
40 0.34
41 0.38
42 0.35
43 0.43
44 0.43
45 0.46
46 0.46
47 0.46
48 0.48
49 0.52
50 0.58
51 0.61
52 0.66
53 0.71
54 0.75
55 0.78
56 0.8
57 0.73
58 0.7
59 0.63
60 0.58
61 0.49
62 0.4
63 0.32
64 0.22
65 0.23
66 0.18
67 0.16
68 0.12
69 0.13
70 0.13
71 0.13
72 0.12
73 0.09
74 0.09
75 0.08
76 0.09
77 0.09
78 0.09
79 0.07
80 0.08
81 0.08
82 0.09
83 0.1
84 0.11
85 0.1
86 0.11
87 0.11
88 0.11
89 0.11
90 0.1
91 0.08
92 0.07
93 0.08
94 0.07
95 0.07
96 0.07
97 0.06
98 0.06
99 0.07
100 0.07
101 0.08
102 0.08
103 0.08
104 0.08
105 0.09
106 0.11
107 0.11
108 0.13
109 0.13
110 0.13
111 0.16
112 0.18
113 0.18
114 0.18
115 0.16
116 0.16
117 0.14
118 0.15
119 0.13
120 0.11
121 0.1
122 0.09
123 0.08
124 0.06
125 0.06
126 0.06
127 0.06
128 0.06
129 0.08
130 0.1
131 0.09
132 0.09
133 0.1
134 0.1
135 0.09
136 0.1
137 0.13
138 0.11
139 0.12
140 0.12
141 0.11
142 0.1
143 0.11
144 0.09
145 0.05
146 0.04
147 0.04
148 0.04
149 0.04
150 0.04
151 0.04
152 0.07
153 0.08
154 0.09
155 0.11
156 0.11
157 0.15
158 0.17
159 0.19
160 0.17
161 0.18
162 0.19
163 0.17
164 0.17
165 0.13
166 0.13
167 0.1
168 0.1
169 0.08
170 0.07
171 0.07
172 0.06
173 0.08
174 0.08
175 0.09
176 0.1
177 0.11
178 0.17
179 0.21
180 0.25
181 0.31
182 0.34
183 0.36
184 0.41
185 0.44
186 0.41
187 0.4
188 0.45
189 0.41
190 0.39
191 0.38
192 0.36
193 0.32
194 0.29
195 0.28
196 0.2
197 0.21
198 0.25
199 0.25
200 0.25
201 0.27
202 0.34
203 0.42