Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W7N983

Protein Details
Accession W7N983   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
28-49SMTRRGCLKGHRQYQKRKKDGIBasic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 8, cyto 4
Family & Domain DBs
KEGG fvr:FVEG_11545  -  
Amino Acid Sequences MPLLSYMVWQPGVWKRREAKCDVWRPASMTRRGCLKGHRQYQKRKKDGIQSSSKSVITGYKKQYSVLWLLMWYHGEGDVAALDRSPLQDREIVHRRDEMAGGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.44
3 0.52
4 0.58
5 0.59
6 0.61
7 0.64
8 0.72
9 0.71
10 0.67
11 0.6
12 0.58
13 0.6
14 0.58
15 0.55
16 0.48
17 0.44
18 0.45
19 0.47
20 0.45
21 0.43
22 0.46
23 0.48
24 0.54
25 0.62
26 0.64
27 0.72
28 0.81
29 0.84
30 0.81
31 0.77
32 0.73
33 0.73
34 0.73
35 0.69
36 0.68
37 0.6
38 0.57
39 0.54
40 0.48
41 0.38
42 0.3
43 0.28
44 0.24
45 0.28
46 0.3
47 0.33
48 0.33
49 0.34
50 0.34
51 0.31
52 0.29
53 0.24
54 0.19
55 0.14
56 0.14
57 0.15
58 0.14
59 0.11
60 0.09
61 0.07
62 0.07
63 0.06
64 0.06
65 0.06
66 0.06
67 0.06
68 0.05
69 0.06
70 0.06
71 0.09
72 0.12
73 0.12
74 0.13
75 0.16
76 0.18
77 0.28
78 0.36
79 0.37
80 0.36
81 0.38
82 0.38
83 0.38