Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q2HGL2

Protein Details
Accession Q2HGL2    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
35-61TETNDKHVPKHKKKPLTRTQPQPQRSPHydrophilic
NLS Segment(s)
PositionSequence
46-47KK
Subcellular Location(s) mito 19, nucl 8
Family & Domain DBs
Amino Acid Sequences MTLSISKIILRCRFQPLDQSNMRQTWGIHAQKPDTETNDKHVPKHKKKPLTRTQPQPQRSPSSSPAVKGSSGSPVYIQLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.5
3 0.46
4 0.48
5 0.48
6 0.5
7 0.46
8 0.43
9 0.43
10 0.34
11 0.3
12 0.27
13 0.32
14 0.31
15 0.3
16 0.31
17 0.31
18 0.32
19 0.35
20 0.31
21 0.26
22 0.27
23 0.24
24 0.28
25 0.35
26 0.34
27 0.34
28 0.41
29 0.48
30 0.53
31 0.63
32 0.66
33 0.67
34 0.74
35 0.82
36 0.83
37 0.83
38 0.82
39 0.82
40 0.84
41 0.84
42 0.82
43 0.78
44 0.74
45 0.71
46 0.66
47 0.62
48 0.55
49 0.55
50 0.52
51 0.46
52 0.45
53 0.39
54 0.36
55 0.31
56 0.28
57 0.26
58 0.25
59 0.24
60 0.2