Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q2HAY1

Protein Details
Accession Q2HAY1   
Localization Confidence High
Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
55-78PNLPGLDKNKKKKQRVYTEKELGIHydrophilic
84-103ITPVGVTKPRGKKKGKVFVDHydrophilic
NLS Segment(s)
PositionSequence
8-69KNKHAAPKAGGSSGGKGPRKSSDGGISKPKGKSGPKAKVPATQIKGRPNLPGLDKNKKKKQR
91-98KPRGKKKG
Subcellular Location(s) nucl 12, mito 11, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR037650  Loc1  
Gene Ontology GO:0003729  F:mRNA binding  
GO:0051028  P:mRNA transport  
GO:0042273  P:ribosomal large subunit biogenesis  
Amino Acid Sequences MAPTRTIKNKHAAPKAGGSSGGKGPRKSSDGGISKPKGKSGPKAKVPATQIKGRPNLPGLDKNKKKKQRVYTEKELGIPELNMITPVGVTKPRGKKKGKVFVDDKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.59
3 0.51
4 0.46
5 0.38
6 0.32
7 0.33
8 0.37
9 0.34
10 0.32
11 0.34
12 0.36
13 0.37
14 0.36
15 0.33
16 0.35
17 0.36
18 0.39
19 0.45
20 0.43
21 0.46
22 0.45
23 0.44
24 0.41
25 0.39
26 0.44
27 0.46
28 0.52
29 0.53
30 0.58
31 0.57
32 0.57
33 0.58
34 0.57
35 0.51
36 0.48
37 0.45
38 0.45
39 0.47
40 0.42
41 0.39
42 0.32
43 0.31
44 0.28
45 0.32
46 0.32
47 0.39
48 0.46
49 0.54
50 0.62
51 0.69
52 0.74
53 0.75
54 0.79
55 0.8
56 0.83
57 0.83
58 0.83
59 0.81
60 0.75
61 0.68
62 0.59
63 0.48
64 0.39
65 0.29
66 0.2
67 0.13
68 0.11
69 0.09
70 0.08
71 0.06
72 0.05
73 0.06
74 0.08
75 0.09
76 0.13
77 0.22
78 0.32
79 0.42
80 0.51
81 0.57
82 0.64
83 0.73
84 0.8
85 0.79
86 0.79