Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W7NB66

Protein Details
Accession W7NB66   
Localization Confidence Medium
Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MPISKKDRRNKEHKRADAAGBasic
NLS Segment(s)
PositionSequence
5-24KKDRRNKEHKRADAAGTRAP
Subcellular Location(s) nucl 21.5, cyto_nucl 13.333, mito_nucl 12.666, cyto 3
Family & Domain DBs
KEGG fvr:FVEG_12108  -  
Amino Acid Sequences MPISKKDRRNKEHKRADAAGTRAPVKPNGLPVKAPKPTSICQNCRKEIVNTNKLQLEVHASTHDAKLWPKEKCWPNDFQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.79
3 0.76
4 0.72
5 0.64
6 0.57
7 0.49
8 0.43
9 0.37
10 0.34
11 0.3
12 0.26
13 0.23
14 0.28
15 0.31
16 0.29
17 0.3
18 0.33
19 0.39
20 0.4
21 0.4
22 0.34
23 0.33
24 0.33
25 0.41
26 0.44
27 0.44
28 0.49
29 0.54
30 0.53
31 0.51
32 0.52
33 0.46
34 0.47
35 0.5
36 0.49
37 0.44
38 0.46
39 0.44
40 0.42
41 0.38
42 0.3
43 0.27
44 0.19
45 0.19
46 0.17
47 0.17
48 0.18
49 0.19
50 0.2
51 0.16
52 0.18
53 0.25
54 0.32
55 0.33
56 0.34
57 0.44
58 0.5
59 0.57