Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W7MSS6

Protein Details
Accession W7MSS6    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
42-67PAYALARKIKEKKHKRDEAKAAEKKLBasic
NLS Segment(s)
PositionSequence
48-66RKIKEKKHKRDEAKAAEKK
Subcellular Location(s) nucl 19.5, cyto_nucl 14, cyto 5.5
Family & Domain DBs
KEGG fvr:FVEG_17265  -  
Amino Acid Sequences MSFRPHPLPFTSKDPRMNDATGEGEAAISDPCLFPCYVASEPAYALARKIKEKKHKRDEAKAAEKKLDDVESTKGKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.55
3 0.54
4 0.5
5 0.42
6 0.36
7 0.31
8 0.23
9 0.2
10 0.15
11 0.1
12 0.09
13 0.09
14 0.06
15 0.04
16 0.04
17 0.04
18 0.04
19 0.06
20 0.06
21 0.06
22 0.06
23 0.1
24 0.1
25 0.11
26 0.12
27 0.11
28 0.11
29 0.13
30 0.13
31 0.09
32 0.1
33 0.13
34 0.15
35 0.21
36 0.28
37 0.35
38 0.45
39 0.56
40 0.66
41 0.73
42 0.81
43 0.83
44 0.87
45 0.88
46 0.88
47 0.88
48 0.84
49 0.77
50 0.72
51 0.64
52 0.55
53 0.49
54 0.4
55 0.31
56 0.26
57 0.29