Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W7MHU9

Protein Details
Accession W7MHU9    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
48-72GLREKLRCKLKQLRESRRRRIERRRBasic
NLS Segment(s)
PositionSequence
49-72LREKLRCKLKQLRESRRRRIERRR
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
KEGG fvr:FVEG_15638  -  
Amino Acid Sequences MKYYQPIDPEDQESEADNIFEKYLERFCLNMEYHKDNFKADRREVRDGLREKLRCKLKQLRESRRRRIERRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.19
3 0.16
4 0.12
5 0.11
6 0.09
7 0.09
8 0.08
9 0.09
10 0.1
11 0.13
12 0.13
13 0.12
14 0.13
15 0.19
16 0.19
17 0.21
18 0.24
19 0.27
20 0.27
21 0.31
22 0.3
23 0.25
24 0.29
25 0.32
26 0.33
27 0.33
28 0.4
29 0.42
30 0.48
31 0.49
32 0.48
33 0.5
34 0.47
35 0.48
36 0.49
37 0.46
38 0.42
39 0.48
40 0.54
41 0.48
42 0.54
43 0.59
44 0.6
45 0.67
46 0.76
47 0.79
48 0.81
49 0.88
50 0.9
51 0.91
52 0.91