Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W7MAF6

Protein Details
Accession W7MAF6    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MTMLKEPWKKYKPFNPPKLPNRTWPDKTHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 9.5, nucl 9, cyto 8, mito 5, pero 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013709  2-isopropylmalate_synth_dimer  
IPR002034  AIPM/Hcit_synth_CS  
IPR013785  Aldolase_TIM  
IPR005668  IPM_Synthase  
IPR036230  LeuA_allosteric_dom_sf  
IPR039371  LeuA_N_DRE-TIM  
IPR000891  PYR_CT  
Gene Ontology GO:0003852  F:2-isopropylmalate synthase activity  
GO:0009098  P:leucine biosynthetic process  
KEGG fvr:FVEG_05491  -  
Pfam View protein in Pfam  
PF00682  HMGL-like  
PF08502  LeuA_dimer  
PROSITE View protein in PROSITE  
PS00815  AIPM_HOMOCIT_SYNTH_1  
PS00816  AIPM_HOMOCIT_SYNTH_2  
PS50991  PYR_CT  
CDD cd07942  DRE_TIM_LeuA  
Amino Acid Sequences MTMLKEPWKKYKPFNPPKLPNRTWPDKTIEKAPRWLSSCLRDGNQSLPDPMNGEEKWRYFKMLCDLGYKEIEVSFPSASQTDFDFTQRLIQTPGAVPDDVFLQVLSPCRPDLIRRTVESVRGAKNAIIHIYLATSACFRQVVFGYTEEQTLELAVECTKLVRSLTKDNPEASGTNWQFEFSPECFSDTDPDYAVRVCQAVKAAWGPDATKGDQIILNLPATVELATPNVYADLIEYFCNNIGDRQDVCISLHPHNDRGCSIAAAELAQMAGADRVEGCLFGNGERTGNVDLVTLALNLYTQGVSPNIDFSDLNSVIDMVESCTKIPVHQRAPYGGSLVCAAFSGSHQDAIKKGFQDRKAKGLGHEDPWNGMPYLPLDPRDIGRNYEAIIRVNSQSGKGGSAFIVHTKLQLDLPRGLQVAFSKVVQKKSEEVGRELLASEITSLFENTYFLNNNPHFSLVDYSITPDRSRSPAPAAHGRTQDTKDFIRIFDGVLLVNGKELKLRGRGNGPISSMVSALKELNIEFDVNDYKEHAIGEGRGVKAASYIECKPVGSKQSVWGVGIHEDVVQSSLIALLSAASNFVTSRPASPVQKATDAPAPQETPSVVSILEEKANGM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.86
3 0.88
4 0.91
5 0.92
6 0.87
7 0.85
8 0.83
9 0.82
10 0.77
11 0.71
12 0.69
13 0.66
14 0.65
15 0.66
16 0.66
17 0.61
18 0.64
19 0.63
20 0.63
21 0.59
22 0.6
23 0.56
24 0.53
25 0.55
26 0.52
27 0.49
28 0.46
29 0.44
30 0.44
31 0.44
32 0.39
33 0.36
34 0.33
35 0.31
36 0.29
37 0.28
38 0.29
39 0.23
40 0.26
41 0.28
42 0.3
43 0.36
44 0.35
45 0.38
46 0.33
47 0.38
48 0.41
49 0.42
50 0.41
51 0.39
52 0.4
53 0.4
54 0.4
55 0.35
56 0.27
57 0.21
58 0.2
59 0.16
60 0.16
61 0.12
62 0.11
63 0.13
64 0.12
65 0.12
66 0.13
67 0.13
68 0.13
69 0.14
70 0.16
71 0.15
72 0.15
73 0.22
74 0.22
75 0.22
76 0.22
77 0.21
78 0.22
79 0.23
80 0.26
81 0.21
82 0.2
83 0.19
84 0.17
85 0.17
86 0.15
87 0.13
88 0.09
89 0.07
90 0.09
91 0.12
92 0.13
93 0.13
94 0.13
95 0.14
96 0.16
97 0.2
98 0.26
99 0.33
100 0.37
101 0.37
102 0.43
103 0.44
104 0.48
105 0.49
106 0.47
107 0.42
108 0.38
109 0.37
110 0.32
111 0.32
112 0.3
113 0.25
114 0.19
115 0.16
116 0.14
117 0.13
118 0.13
119 0.1
120 0.09
121 0.09
122 0.08
123 0.09
124 0.09
125 0.09
126 0.11
127 0.12
128 0.14
129 0.15
130 0.16
131 0.17
132 0.18
133 0.18
134 0.15
135 0.14
136 0.11
137 0.1
138 0.09
139 0.06
140 0.06
141 0.06
142 0.06
143 0.06
144 0.07
145 0.07
146 0.08
147 0.09
148 0.12
149 0.17
150 0.25
151 0.33
152 0.39
153 0.42
154 0.41
155 0.42
156 0.4
157 0.36
158 0.29
159 0.32
160 0.26
161 0.25
162 0.24
163 0.22
164 0.2
165 0.21
166 0.24
167 0.14
168 0.18
169 0.17
170 0.19
171 0.19
172 0.19
173 0.21
174 0.19
175 0.19
176 0.15
177 0.15
178 0.14
179 0.14
180 0.14
181 0.11
182 0.09
183 0.08
184 0.09
185 0.1
186 0.09
187 0.11
188 0.12
189 0.12
190 0.13
191 0.13
192 0.13
193 0.15
194 0.18
195 0.17
196 0.17
197 0.16
198 0.16
199 0.16
200 0.16
201 0.14
202 0.13
203 0.12
204 0.1
205 0.1
206 0.09
207 0.08
208 0.08
209 0.06
210 0.05
211 0.05
212 0.06
213 0.06
214 0.06
215 0.06
216 0.05
217 0.05
218 0.05
219 0.06
220 0.06
221 0.06
222 0.06
223 0.07
224 0.07
225 0.08
226 0.08
227 0.08
228 0.08
229 0.11
230 0.11
231 0.13
232 0.13
233 0.13
234 0.14
235 0.17
236 0.2
237 0.19
238 0.25
239 0.24
240 0.27
241 0.28
242 0.28
243 0.24
244 0.23
245 0.21
246 0.15
247 0.14
248 0.1
249 0.09
250 0.08
251 0.07
252 0.05
253 0.04
254 0.04
255 0.04
256 0.03
257 0.03
258 0.03
259 0.03
260 0.03
261 0.04
262 0.04
263 0.04
264 0.04
265 0.05
266 0.05
267 0.06
268 0.08
269 0.08
270 0.08
271 0.08
272 0.1
273 0.1
274 0.1
275 0.1
276 0.07
277 0.07
278 0.07
279 0.07
280 0.05
281 0.04
282 0.04
283 0.04
284 0.04
285 0.04
286 0.03
287 0.03
288 0.04
289 0.04
290 0.05
291 0.05
292 0.06
293 0.06
294 0.07
295 0.07
296 0.07
297 0.13
298 0.13
299 0.13
300 0.12
301 0.12
302 0.1
303 0.11
304 0.1
305 0.04
306 0.06
307 0.07
308 0.07
309 0.08
310 0.08
311 0.1
312 0.15
313 0.22
314 0.24
315 0.28
316 0.29
317 0.3
318 0.33
319 0.31
320 0.27
321 0.2
322 0.16
323 0.13
324 0.11
325 0.09
326 0.07
327 0.06
328 0.05
329 0.05
330 0.09
331 0.08
332 0.11
333 0.11
334 0.12
335 0.13
336 0.16
337 0.18
338 0.15
339 0.2
340 0.24
341 0.31
342 0.4
343 0.4
344 0.43
345 0.45
346 0.45
347 0.42
348 0.43
349 0.4
350 0.33
351 0.36
352 0.31
353 0.28
354 0.28
355 0.27
356 0.19
357 0.16
358 0.13
359 0.1
360 0.13
361 0.13
362 0.14
363 0.14
364 0.15
365 0.16
366 0.2
367 0.2
368 0.18
369 0.18
370 0.17
371 0.17
372 0.2
373 0.2
374 0.16
375 0.16
376 0.16
377 0.16
378 0.17
379 0.17
380 0.14
381 0.15
382 0.14
383 0.14
384 0.12
385 0.12
386 0.1
387 0.11
388 0.11
389 0.1
390 0.12
391 0.11
392 0.12
393 0.12
394 0.13
395 0.14
396 0.16
397 0.18
398 0.18
399 0.19
400 0.2
401 0.2
402 0.19
403 0.18
404 0.16
405 0.16
406 0.14
407 0.14
408 0.19
409 0.23
410 0.28
411 0.28
412 0.29
413 0.29
414 0.33
415 0.38
416 0.33
417 0.31
418 0.3
419 0.28
420 0.27
421 0.24
422 0.19
423 0.14
424 0.11
425 0.09
426 0.07
427 0.07
428 0.07
429 0.07
430 0.07
431 0.07
432 0.07
433 0.07
434 0.1
435 0.11
436 0.11
437 0.2
438 0.2
439 0.23
440 0.23
441 0.23
442 0.21
443 0.21
444 0.23
445 0.15
446 0.17
447 0.14
448 0.17
449 0.18
450 0.2
451 0.19
452 0.17
453 0.19
454 0.21
455 0.23
456 0.23
457 0.25
458 0.27
459 0.33
460 0.4
461 0.43
462 0.45
463 0.47
464 0.46
465 0.47
466 0.47
467 0.45
468 0.4
469 0.36
470 0.35
471 0.33
472 0.3
473 0.28
474 0.25
475 0.22
476 0.19
477 0.18
478 0.12
479 0.12
480 0.13
481 0.09
482 0.1
483 0.1
484 0.09
485 0.1
486 0.11
487 0.15
488 0.22
489 0.24
490 0.27
491 0.32
492 0.38
493 0.4
494 0.42
495 0.4
496 0.35
497 0.34
498 0.31
499 0.26
500 0.21
501 0.17
502 0.15
503 0.13
504 0.11
505 0.1
506 0.1
507 0.12
508 0.12
509 0.12
510 0.1
511 0.13
512 0.16
513 0.15
514 0.16
515 0.15
516 0.15
517 0.15
518 0.15
519 0.14
520 0.12
521 0.12
522 0.17
523 0.21
524 0.21
525 0.21
526 0.21
527 0.2
528 0.19
529 0.2
530 0.17
531 0.17
532 0.18
533 0.21
534 0.22
535 0.23
536 0.23
537 0.28
538 0.31
539 0.31
540 0.31
541 0.33
542 0.4
543 0.41
544 0.39
545 0.35
546 0.31
547 0.28
548 0.27
549 0.21
550 0.14
551 0.13
552 0.12
553 0.11
554 0.09
555 0.07
556 0.06
557 0.07
558 0.06
559 0.06
560 0.05
561 0.05
562 0.06
563 0.06
564 0.07
565 0.06
566 0.06
567 0.07
568 0.07
569 0.11
570 0.11
571 0.13
572 0.19
573 0.25
574 0.29
575 0.35
576 0.41
577 0.42
578 0.47
579 0.45
580 0.44
581 0.45
582 0.42
583 0.39
584 0.38
585 0.36
586 0.31
587 0.32
588 0.29
589 0.24
590 0.23
591 0.21
592 0.14
593 0.14
594 0.15
595 0.16
596 0.17