Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W7M6S4

Protein Details
Accession W7M6S4    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
71-91NHFYNREKTFRKRTGKYTKLDHydrophilic
NLS Segment(s)
PositionSequence
54-86QARRGIKKAASKAKNMRNHFYNREKTFRKRTGK
Subcellular Location(s) mito 13.5, mito_nucl 12.666, nucl 10.5, cyto_nucl 7.333
Family & Domain DBs
KEGG fvr:FVEG_15538  -  
Amino Acid Sequences MSGLIRSLWSRPSWSSSSSSPSKSDQSSKSSQFSQQVKKSIEEYGQRMNAKMGQARRGIKKAASKAKNMRNHFYNREKTFRKRTGKYTKLDWSKSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.32
3 0.31
4 0.36
5 0.37
6 0.37
7 0.34
8 0.35
9 0.36
10 0.36
11 0.4
12 0.37
13 0.39
14 0.43
15 0.44
16 0.44
17 0.42
18 0.42
19 0.43
20 0.46
21 0.48
22 0.47
23 0.5
24 0.48
25 0.48
26 0.45
27 0.39
28 0.36
29 0.31
30 0.29
31 0.27
32 0.3
33 0.28
34 0.27
35 0.26
36 0.23
37 0.21
38 0.22
39 0.19
40 0.19
41 0.24
42 0.29
43 0.33
44 0.33
45 0.34
46 0.34
47 0.39
48 0.43
49 0.48
50 0.47
51 0.5
52 0.57
53 0.64
54 0.69
55 0.68
56 0.66
57 0.62
58 0.66
59 0.66
60 0.67
61 0.68
62 0.64
63 0.69
64 0.69
65 0.71
66 0.75
67 0.76
68 0.77
69 0.74
70 0.79
71 0.8
72 0.82
73 0.78
74 0.76
75 0.76
76 0.76