Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W7M243

Protein Details
Accession W7M243    Localization Confidence Low Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
199-218PPMPRPDRRTPGPQMRRPNFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20.5, cyto_mito 11.5, nucl 4
Family & Domain DBs
KEGG fvr:FVEG_06364  -  
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MFPRSYPYSGKSIFRMDPDCAICHAPASMACECEAKGLDVAVKQAEDRMMRSIYNEIRSWVRGHAQDYILEYFRLLTDQRKTAHAAHMDRITAHAYHYYHAPPHPTQVAEAQASLKRGIDEDWQASVQRYPEVLEYFFGLVELTLPAEDEPAVKDPPLGSLSNSRKVNRRSGTAPPGASAVVAPPGYRGDPGQMHPQEPPMPRPDRRTPGPQMRRPNFGAIPPPMPGAYNFPPPY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.43
3 0.38
4 0.4
5 0.39
6 0.37
7 0.33
8 0.32
9 0.26
10 0.23
11 0.21
12 0.15
13 0.14
14 0.17
15 0.16
16 0.15
17 0.16
18 0.16
19 0.16
20 0.17
21 0.17
22 0.13
23 0.12
24 0.12
25 0.13
26 0.12
27 0.14
28 0.12
29 0.12
30 0.11
31 0.12
32 0.15
33 0.14
34 0.15
35 0.17
36 0.17
37 0.17
38 0.19
39 0.24
40 0.24
41 0.27
42 0.26
43 0.25
44 0.26
45 0.28
46 0.28
47 0.24
48 0.24
49 0.23
50 0.24
51 0.26
52 0.25
53 0.24
54 0.26
55 0.26
56 0.22
57 0.19
58 0.17
59 0.13
60 0.12
61 0.12
62 0.1
63 0.12
64 0.16
65 0.2
66 0.22
67 0.23
68 0.27
69 0.27
70 0.32
71 0.33
72 0.31
73 0.3
74 0.31
75 0.29
76 0.26
77 0.25
78 0.21
79 0.14
80 0.13
81 0.13
82 0.12
83 0.12
84 0.14
85 0.14
86 0.14
87 0.15
88 0.19
89 0.16
90 0.18
91 0.19
92 0.17
93 0.17
94 0.17
95 0.19
96 0.14
97 0.14
98 0.13
99 0.13
100 0.14
101 0.13
102 0.11
103 0.09
104 0.09
105 0.1
106 0.1
107 0.11
108 0.11
109 0.12
110 0.12
111 0.12
112 0.12
113 0.13
114 0.11
115 0.09
116 0.09
117 0.08
118 0.1
119 0.11
120 0.11
121 0.1
122 0.1
123 0.1
124 0.09
125 0.08
126 0.06
127 0.05
128 0.05
129 0.04
130 0.04
131 0.03
132 0.04
133 0.04
134 0.04
135 0.04
136 0.04
137 0.06
138 0.08
139 0.09
140 0.08
141 0.09
142 0.09
143 0.12
144 0.14
145 0.13
146 0.12
147 0.21
148 0.26
149 0.34
150 0.38
151 0.37
152 0.43
153 0.47
154 0.55
155 0.49
156 0.49
157 0.45
158 0.49
159 0.54
160 0.51
161 0.48
162 0.39
163 0.36
164 0.31
165 0.27
166 0.19
167 0.12
168 0.1
169 0.1
170 0.09
171 0.09
172 0.11
173 0.11
174 0.12
175 0.12
176 0.13
177 0.16
178 0.2
179 0.29
180 0.29
181 0.3
182 0.3
183 0.34
184 0.36
185 0.36
186 0.38
187 0.36
188 0.42
189 0.45
190 0.53
191 0.58
192 0.59
193 0.63
194 0.67
195 0.69
196 0.72
197 0.78
198 0.79
199 0.8
200 0.77
201 0.77
202 0.72
203 0.69
204 0.6
205 0.54
206 0.53
207 0.47
208 0.44
209 0.39
210 0.37
211 0.3
212 0.29
213 0.26
214 0.26
215 0.25