Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W7LU76

Protein Details
Accession W7LU76    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
104-125ADNFAFKTTKKPHYKSWKCGPPHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 19, mito 2, cyto 2, vacu 2, cyto_mito 2
Family & Domain DBs
KEGG fvr:FVEG_00265  -  
Amino Acid Sequences MHLFSLITITTLSLGASAMAIEEDTTLEARTDHCNPGIDLIKLKIKPGKSFTGVGKPGKCYNLPANVKNFDVYSDDTKSLVSCFDCKVYTEANCKGSFVSLEGADNFAFKTTKKPHYKSWKCGPP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.05
4 0.05
5 0.04
6 0.04
7 0.04
8 0.04
9 0.04
10 0.04
11 0.05
12 0.06
13 0.06
14 0.06
15 0.06
16 0.08
17 0.13
18 0.16
19 0.17
20 0.18
21 0.19
22 0.19
23 0.24
24 0.25
25 0.21
26 0.19
27 0.19
28 0.23
29 0.22
30 0.25
31 0.24
32 0.23
33 0.27
34 0.3
35 0.33
36 0.3
37 0.33
38 0.33
39 0.37
40 0.39
41 0.39
42 0.36
43 0.34
44 0.34
45 0.33
46 0.3
47 0.25
48 0.25
49 0.3
50 0.32
51 0.32
52 0.34
53 0.33
54 0.33
55 0.31
56 0.27
57 0.18
58 0.17
59 0.17
60 0.16
61 0.16
62 0.16
63 0.16
64 0.16
65 0.15
66 0.13
67 0.12
68 0.1
69 0.09
70 0.1
71 0.12
72 0.13
73 0.14
74 0.16
75 0.17
76 0.2
77 0.25
78 0.28
79 0.3
80 0.3
81 0.29
82 0.27
83 0.25
84 0.21
85 0.17
86 0.14
87 0.11
88 0.12
89 0.12
90 0.14
91 0.12
92 0.12
93 0.11
94 0.1
95 0.1
96 0.09
97 0.19
98 0.25
99 0.36
100 0.46
101 0.51
102 0.59
103 0.7
104 0.8
105 0.8