Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C4VA38

Protein Details
Accession C4VA38    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
124-152EKSFNELKKEKKERIKVNIRNQRANKKRKBasic
NLS Segment(s)
PositionSequence
81-90AAKKGIKKKK
131-152KKEKKERIKVNIRNQRANKKRK
Subcellular Location(s) nucl 17, cyto_nucl 13.5, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR007023  Ribosom_reg  
Gene Ontology GO:0005634  C:nucleus  
GO:0042254  P:ribosome biogenesis  
KEGG nce:NCER_101473  -  
Pfam View protein in Pfam  
PF04939  RRS1  
Amino Acid Sequences MKAYLNLLTVTKNVDFPLKDNIHTEINKEASAMIAFFKKEVKKHKTVQKDLDLVYVLDQNDYQIPMQYSEKQAKTKWEAFAAKKGIKKKKGSLVYDEELKKYIPRFGPYSKKNLLLKSAVLEGEKSFNELKKEKKERIKVNIRNQRANKKRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.21
4 0.3
5 0.28
6 0.29
7 0.3
8 0.32
9 0.33
10 0.33
11 0.33
12 0.29
13 0.28
14 0.27
15 0.25
16 0.21
17 0.15
18 0.15
19 0.13
20 0.09
21 0.09
22 0.09
23 0.1
24 0.15
25 0.18
26 0.23
27 0.33
28 0.39
29 0.45
30 0.54
31 0.62
32 0.67
33 0.72
34 0.74
35 0.71
36 0.67
37 0.6
38 0.53
39 0.45
40 0.35
41 0.28
42 0.23
43 0.15
44 0.11
45 0.1
46 0.09
47 0.09
48 0.1
49 0.09
50 0.08
51 0.08
52 0.1
53 0.12
54 0.14
55 0.17
56 0.22
57 0.25
58 0.26
59 0.27
60 0.3
61 0.34
62 0.36
63 0.33
64 0.32
65 0.35
66 0.34
67 0.39
68 0.39
69 0.37
70 0.37
71 0.44
72 0.47
73 0.5
74 0.53
75 0.53
76 0.57
77 0.62
78 0.61
79 0.58
80 0.57
81 0.52
82 0.54
83 0.49
84 0.4
85 0.33
86 0.3
87 0.26
88 0.21
89 0.24
90 0.2
91 0.23
92 0.27
93 0.33
94 0.43
95 0.44
96 0.51
97 0.48
98 0.53
99 0.53
100 0.51
101 0.48
102 0.4
103 0.38
104 0.32
105 0.31
106 0.25
107 0.21
108 0.19
109 0.16
110 0.17
111 0.16
112 0.17
113 0.17
114 0.19
115 0.25
116 0.29
117 0.36
118 0.44
119 0.53
120 0.59
121 0.67
122 0.74
123 0.77
124 0.83
125 0.86
126 0.85
127 0.88
128 0.89
129 0.86
130 0.87
131 0.86
132 0.86