Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4V9H4

Protein Details
Accession C4V9H4   
Localization Confidence Low
Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
234-253ADDNGFIKTHKKNSKKQYKYHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 12, nucl 11, cyto 11, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR035445  GYF-like_dom_sf  
KEGG nce:NCER_101218  -  
Amino Acid Sequences MKDLHKILTVKSLKPKIWNPNLHIMNEEPHTIKTLTPFTPDEKFLVFKRKIIAPLLRSQKNKNTLTSQKEDRWLVKTSNNDILGPYTKSEMKQFIDNNKFTDAYMKRDYDKDFVDFQILCSIPDFLESEKTDEFFKEINDKLENLQIEDKPSSMQNNTENNTFLVKERTRFCKCTEFLLLKKININIDLLIKKLYGKNRETAVNLVGFLTNLKIEDCEKLVNLIILESKNSVIADDNGFIKTHKKNSKKQYKY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.63
3 0.64
4 0.7
5 0.72
6 0.67
7 0.71
8 0.71
9 0.63
10 0.57
11 0.48
12 0.42
13 0.36
14 0.33
15 0.24
16 0.2
17 0.23
18 0.21
19 0.21
20 0.21
21 0.25
22 0.23
23 0.26
24 0.28
25 0.28
26 0.31
27 0.32
28 0.29
29 0.26
30 0.28
31 0.27
32 0.35
33 0.32
34 0.31
35 0.34
36 0.36
37 0.37
38 0.4
39 0.43
40 0.37
41 0.44
42 0.51
43 0.54
44 0.53
45 0.56
46 0.58
47 0.61
48 0.6
49 0.56
50 0.55
51 0.57
52 0.6
53 0.61
54 0.59
55 0.54
56 0.57
57 0.55
58 0.5
59 0.45
60 0.41
61 0.37
62 0.35
63 0.36
64 0.35
65 0.38
66 0.36
67 0.32
68 0.29
69 0.29
70 0.27
71 0.23
72 0.19
73 0.15
74 0.16
75 0.16
76 0.19
77 0.2
78 0.19
79 0.24
80 0.27
81 0.34
82 0.4
83 0.41
84 0.4
85 0.37
86 0.36
87 0.3
88 0.35
89 0.27
90 0.26
91 0.29
92 0.28
93 0.28
94 0.31
95 0.33
96 0.28
97 0.28
98 0.24
99 0.21
100 0.2
101 0.21
102 0.18
103 0.16
104 0.18
105 0.16
106 0.14
107 0.12
108 0.12
109 0.09
110 0.1
111 0.1
112 0.06
113 0.1
114 0.1
115 0.12
116 0.12
117 0.13
118 0.12
119 0.12
120 0.13
121 0.09
122 0.1
123 0.12
124 0.13
125 0.15
126 0.16
127 0.16
128 0.16
129 0.19
130 0.18
131 0.15
132 0.17
133 0.15
134 0.17
135 0.16
136 0.16
137 0.13
138 0.14
139 0.15
140 0.13
141 0.15
142 0.19
143 0.24
144 0.26
145 0.27
146 0.26
147 0.25
148 0.25
149 0.23
150 0.17
151 0.19
152 0.19
153 0.23
154 0.27
155 0.35
156 0.39
157 0.41
158 0.44
159 0.46
160 0.45
161 0.46
162 0.48
163 0.45
164 0.41
165 0.48
166 0.46
167 0.38
168 0.4
169 0.37
170 0.32
171 0.27
172 0.26
173 0.18
174 0.21
175 0.21
176 0.18
177 0.17
178 0.15
179 0.17
180 0.21
181 0.27
182 0.29
183 0.31
184 0.35
185 0.38
186 0.41
187 0.41
188 0.39
189 0.34
190 0.27
191 0.25
192 0.2
193 0.17
194 0.14
195 0.12
196 0.1
197 0.08
198 0.07
199 0.07
200 0.08
201 0.09
202 0.12
203 0.13
204 0.14
205 0.14
206 0.15
207 0.15
208 0.15
209 0.14
210 0.12
211 0.14
212 0.13
213 0.14
214 0.14
215 0.13
216 0.13
217 0.13
218 0.13
219 0.12
220 0.14
221 0.15
222 0.16
223 0.17
224 0.17
225 0.17
226 0.17
227 0.22
228 0.26
229 0.34
230 0.42
231 0.5
232 0.59
233 0.7