Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4V8W8

Protein Details
Accession C4V8W8    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
309-340EKRFLNKKDLKIKLSKKSKKEIEKFVEKNKGYBasic
NLS Segment(s)
PositionSequence
315-331KKDLKIKLSKKSKKEIE
Subcellular Location(s) nucl 11.5, cyto_nucl 10.5, cyto 8.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR024079  MetalloPept_cat_dom_sf  
Gene Ontology GO:0008237  F:metallopeptidase activity  
KEGG nce:NCER_100968  -  
Pfam View protein in Pfam  
PF13688  Reprolysin_5  
Amino Acid Sequences MLICLFYYASAEVTSVNYYNLNDTLLTKSDFKIRNFKFKISDKTFIFSNGSRNYISDPCVYTLVTKNTFGYLKVCNGVEGLICTSIECLEIKYVKKKDPYHLDVETYPLDKVLVKFNDNFKSEIYTTTQSLSSDNRIIENRIHIKNKRIIKIRLALINEYDRYIKLKNHAYIETLHLFKVARKIINSLNFDNFSLDIVKTSIVNRSKSNLLIDNQKDPLSTLNANITKLKDINSYLYNSDLIVLLTDNKTNEKEGMSYLNGLGDVDTKYIIINYNPDDTLFYKAKVLVHEILHTLGSTHDLENKGYLMEKRFLNKKDLKIKLSKKSKKEIEKFVEKNKGYFFGDSKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.12
4 0.13
5 0.13
6 0.16
7 0.16
8 0.15
9 0.14
10 0.15
11 0.17
12 0.18
13 0.21
14 0.2
15 0.21
16 0.29
17 0.34
18 0.37
19 0.44
20 0.46
21 0.55
22 0.57
23 0.61
24 0.61
25 0.63
26 0.69
27 0.66
28 0.69
29 0.6
30 0.59
31 0.54
32 0.48
33 0.44
34 0.36
35 0.36
36 0.32
37 0.33
38 0.3
39 0.3
40 0.32
41 0.3
42 0.31
43 0.26
44 0.25
45 0.24
46 0.24
47 0.24
48 0.22
49 0.26
50 0.3
51 0.28
52 0.27
53 0.26
54 0.28
55 0.29
56 0.26
57 0.24
58 0.2
59 0.2
60 0.22
61 0.22
62 0.19
63 0.18
64 0.18
65 0.15
66 0.13
67 0.11
68 0.09
69 0.09
70 0.08
71 0.08
72 0.08
73 0.08
74 0.07
75 0.07
76 0.1
77 0.14
78 0.17
79 0.26
80 0.3
81 0.35
82 0.43
83 0.47
84 0.53
85 0.59
86 0.61
87 0.58
88 0.56
89 0.53
90 0.45
91 0.43
92 0.36
93 0.27
94 0.22
95 0.15
96 0.14
97 0.12
98 0.13
99 0.18
100 0.18
101 0.2
102 0.24
103 0.3
104 0.36
105 0.36
106 0.36
107 0.28
108 0.31
109 0.29
110 0.27
111 0.25
112 0.2
113 0.2
114 0.2
115 0.2
116 0.16
117 0.17
118 0.17
119 0.16
120 0.17
121 0.16
122 0.17
123 0.18
124 0.19
125 0.19
126 0.23
127 0.27
128 0.29
129 0.36
130 0.35
131 0.41
132 0.46
133 0.52
134 0.52
135 0.53
136 0.51
137 0.5
138 0.54
139 0.51
140 0.48
141 0.43
142 0.36
143 0.31
144 0.3
145 0.25
146 0.2
147 0.17
148 0.13
149 0.14
150 0.15
151 0.14
152 0.17
153 0.23
154 0.25
155 0.27
156 0.28
157 0.27
158 0.26
159 0.28
160 0.26
161 0.2
162 0.17
163 0.14
164 0.14
165 0.14
166 0.19
167 0.18
168 0.17
169 0.17
170 0.2
171 0.23
172 0.3
173 0.33
174 0.29
175 0.29
176 0.28
177 0.28
178 0.25
179 0.21
180 0.15
181 0.12
182 0.1
183 0.08
184 0.07
185 0.07
186 0.07
187 0.08
188 0.14
189 0.17
190 0.19
191 0.2
192 0.22
193 0.24
194 0.25
195 0.27
196 0.24
197 0.22
198 0.29
199 0.3
200 0.3
201 0.3
202 0.29
203 0.26
204 0.22
205 0.22
206 0.17
207 0.16
208 0.13
209 0.19
210 0.2
211 0.22
212 0.23
213 0.22
214 0.21
215 0.21
216 0.22
217 0.18
218 0.18
219 0.2
220 0.2
221 0.21
222 0.19
223 0.2
224 0.18
225 0.15
226 0.14
227 0.11
228 0.09
229 0.07
230 0.07
231 0.08
232 0.08
233 0.1
234 0.1
235 0.12
236 0.13
237 0.14
238 0.15
239 0.14
240 0.14
241 0.14
242 0.17
243 0.16
244 0.16
245 0.15
246 0.14
247 0.13
248 0.12
249 0.1
250 0.09
251 0.08
252 0.08
253 0.07
254 0.07
255 0.07
256 0.08
257 0.09
258 0.08
259 0.12
260 0.14
261 0.17
262 0.17
263 0.17
264 0.19
265 0.19
266 0.24
267 0.22
268 0.2
269 0.19
270 0.21
271 0.23
272 0.23
273 0.26
274 0.25
275 0.24
276 0.25
277 0.24
278 0.23
279 0.21
280 0.19
281 0.14
282 0.1
283 0.12
284 0.11
285 0.11
286 0.16
287 0.17
288 0.18
289 0.19
290 0.19
291 0.17
292 0.19
293 0.21
294 0.21
295 0.25
296 0.27
297 0.34
298 0.41
299 0.44
300 0.5
301 0.54
302 0.59
303 0.64
304 0.69
305 0.69
306 0.71
307 0.78
308 0.78
309 0.82
310 0.82
311 0.8
312 0.83
313 0.86
314 0.86
315 0.86
316 0.86
317 0.85
318 0.86
319 0.85
320 0.84
321 0.84
322 0.74
323 0.7
324 0.63
325 0.59
326 0.51
327 0.48