Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4V942

Protein Details
Accession C4V942   
Localization Confidence Medium
Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
23-47KTPSGKLVARKQKKHAKFHRCHECNBasic
NLS Segment(s)
PositionSequence
18-39VRKVVKTPSGKLVARKQKKHAK
Subcellular Location(s) nucl 15, mito 8, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR008195  Ribosomal_L34Ae  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG nce:NCER_101051  -  
Pfam View protein in Pfam  
PF01199  Ribosomal_L34e  
Amino Acid Sequences MHKIIIHKGRTYKTRSNVRKVVKTPSGKLVARKQKKHAKFHRCHECNTKLLSIARMRPAEFSRQKVSARRVNRPLGSTTCGRCVREKIVEAFLNDEEKIVREKAAAN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.73
3 0.75
4 0.77
5 0.78
6 0.79
7 0.74
8 0.74
9 0.72
10 0.69
11 0.63
12 0.61
13 0.6
14 0.53
15 0.56
16 0.57
17 0.59
18 0.62
19 0.65
20 0.67
21 0.7
22 0.76
23 0.8
24 0.81
25 0.81
26 0.8
27 0.84
28 0.86
29 0.78
30 0.75
31 0.73
32 0.67
33 0.59
34 0.53
35 0.44
36 0.34
37 0.33
38 0.32
39 0.25
40 0.24
41 0.25
42 0.23
43 0.23
44 0.23
45 0.24
46 0.3
47 0.31
48 0.32
49 0.31
50 0.34
51 0.37
52 0.4
53 0.45
54 0.44
55 0.46
56 0.51
57 0.54
58 0.57
59 0.57
60 0.53
61 0.51
62 0.46
63 0.44
64 0.39
65 0.35
66 0.36
67 0.37
68 0.37
69 0.36
70 0.37
71 0.4
72 0.41
73 0.43
74 0.38
75 0.41
76 0.42
77 0.39
78 0.38
79 0.33
80 0.3
81 0.26
82 0.23
83 0.16
84 0.15
85 0.18
86 0.15
87 0.15