Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4VC06

Protein Details
Accession C4VC06    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
35-54INAIRFDTRKKKNKEDFLNSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, mito 8
Family & Domain DBs
KEGG nce:NCER_102432  -  
Amino Acid Sequences MPQFIKKLEISNLSDDLKQKSIFALRNLSSFLDTINAIRFDTRKKKNKEDFLNSLNLACYQFSRYTGVSQKLLIFKLICKNIHKVDDSVFCKVSGCDFYEVNRLLFYIDRRFNSFYGRLFKLREIVEKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.36
3 0.34
4 0.32
5 0.28
6 0.24
7 0.24
8 0.29
9 0.3
10 0.31
11 0.34
12 0.31
13 0.32
14 0.33
15 0.31
16 0.25
17 0.21
18 0.18
19 0.12
20 0.11
21 0.1
22 0.12
23 0.12
24 0.11
25 0.12
26 0.13
27 0.2
28 0.3
29 0.39
30 0.45
31 0.52
32 0.63
33 0.7
34 0.79
35 0.8
36 0.78
37 0.75
38 0.68
39 0.65
40 0.54
41 0.45
42 0.36
43 0.27
44 0.19
45 0.13
46 0.11
47 0.09
48 0.09
49 0.1
50 0.12
51 0.12
52 0.14
53 0.19
54 0.21
55 0.19
56 0.19
57 0.21
58 0.21
59 0.2
60 0.19
61 0.15
62 0.15
63 0.21
64 0.24
65 0.25
66 0.25
67 0.3
68 0.32
69 0.36
70 0.35
71 0.29
72 0.29
73 0.35
74 0.35
75 0.33
76 0.3
77 0.26
78 0.25
79 0.24
80 0.23
81 0.16
82 0.16
83 0.15
84 0.15
85 0.17
86 0.24
87 0.25
88 0.23
89 0.2
90 0.18
91 0.17
92 0.19
93 0.21
94 0.22
95 0.27
96 0.29
97 0.33
98 0.36
99 0.36
100 0.4
101 0.4
102 0.37
103 0.39
104 0.41
105 0.4
106 0.41
107 0.42
108 0.42
109 0.41