Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C4VB49

Protein Details
Accession C4VB49    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
88-108SYAKRFKQWYRQQFIKHEKVRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR036397  RNaseH_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
KEGG nce:NCER_101970  -  
Amino Acid Sequences MRKLCKTLSIERRRLSLESHRINGRIDRTIRTIRDGILKSKKESFTDKVYEAIEKYNLSFHAGLKCILVEAVDDKTGTVMIENNSQGSYAKRFKQWYRQQFIKHEKVRAAKNENLKGCN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.52
3 0.51
4 0.51
5 0.49
6 0.51
7 0.51
8 0.49
9 0.5
10 0.49
11 0.42
12 0.39
13 0.35
14 0.33
15 0.36
16 0.41
17 0.4
18 0.4
19 0.37
20 0.31
21 0.37
22 0.36
23 0.37
24 0.4
25 0.42
26 0.4
27 0.45
28 0.46
29 0.41
30 0.44
31 0.41
32 0.37
33 0.39
34 0.36
35 0.32
36 0.3
37 0.28
38 0.23
39 0.21
40 0.16
41 0.12
42 0.12
43 0.11
44 0.1
45 0.11
46 0.11
47 0.11
48 0.13
49 0.13
50 0.13
51 0.12
52 0.11
53 0.09
54 0.08
55 0.07
56 0.04
57 0.05
58 0.06
59 0.06
60 0.06
61 0.06
62 0.06
63 0.07
64 0.06
65 0.05
66 0.06
67 0.07
68 0.11
69 0.11
70 0.12
71 0.12
72 0.12
73 0.13
74 0.13
75 0.19
76 0.21
77 0.25
78 0.3
79 0.37
80 0.43
81 0.53
82 0.61
83 0.65
84 0.68
85 0.72
86 0.73
87 0.77
88 0.81
89 0.8
90 0.76
91 0.71
92 0.69
93 0.69
94 0.7
95 0.69
96 0.66
97 0.62
98 0.66
99 0.69