Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C4V6L4

Protein Details
Accession C4V6L4    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
200-219LDCKLFKYKIKYNKKEIFCHHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 14.5, cyto 13.5, nucl 10.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002761  Diphthami_syn_dom  
IPR030662  DPH6/MJ0570  
IPR014729  Rossmann-like_a/b/a_fold  
Gene Ontology GO:0017178  F:diphthine-ammonia ligase activity  
KEGG nce:NCER_100049  -  
Pfam View protein in Pfam  
PF01902  Diphthami_syn_2  
CDD cd01994  Alpha_ANH_like_IV  
Amino Acid Sequences MKFIALVSGGKDSIYTIQVLKEQGHTPVGLLYMKNTSSYVDSYMYQTVGSEVVELFGKCMDLPLFLYETKCETVNTELEYKINETDEVEDLYEAIKDVQTKLDFDAISSGAILSMYQKNRILNVAQRLNISSLTPLWGRNQRELLIEMVENEIKAEIVKIASSFLDKTWIGTDISKILETNICLYENFCGEGGEYETVVLDCKLFKYKIKYNKKEIFCHPDENIDNATVFFSKYINLSLVKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.12
4 0.14
5 0.17
6 0.19
7 0.19
8 0.21
9 0.21
10 0.22
11 0.23
12 0.21
13 0.18
14 0.17
15 0.18
16 0.16
17 0.14
18 0.13
19 0.15
20 0.15
21 0.16
22 0.15
23 0.15
24 0.15
25 0.16
26 0.17
27 0.16
28 0.16
29 0.18
30 0.19
31 0.18
32 0.15
33 0.14
34 0.12
35 0.1
36 0.09
37 0.07
38 0.06
39 0.06
40 0.08
41 0.08
42 0.08
43 0.07
44 0.08
45 0.07
46 0.08
47 0.08
48 0.07
49 0.08
50 0.09
51 0.11
52 0.12
53 0.13
54 0.12
55 0.14
56 0.15
57 0.14
58 0.13
59 0.13
60 0.15
61 0.16
62 0.18
63 0.17
64 0.17
65 0.16
66 0.17
67 0.16
68 0.14
69 0.13
70 0.11
71 0.09
72 0.11
73 0.11
74 0.11
75 0.1
76 0.08
77 0.08
78 0.08
79 0.07
80 0.05
81 0.05
82 0.05
83 0.05
84 0.06
85 0.1
86 0.1
87 0.11
88 0.12
89 0.15
90 0.14
91 0.13
92 0.14
93 0.11
94 0.1
95 0.09
96 0.08
97 0.05
98 0.05
99 0.05
100 0.06
101 0.1
102 0.1
103 0.13
104 0.15
105 0.15
106 0.16
107 0.18
108 0.16
109 0.16
110 0.23
111 0.24
112 0.23
113 0.23
114 0.23
115 0.23
116 0.21
117 0.17
118 0.11
119 0.08
120 0.09
121 0.09
122 0.09
123 0.13
124 0.19
125 0.21
126 0.23
127 0.25
128 0.24
129 0.25
130 0.25
131 0.22
132 0.17
133 0.15
134 0.12
135 0.12
136 0.11
137 0.09
138 0.08
139 0.07
140 0.05
141 0.05
142 0.05
143 0.04
144 0.04
145 0.05
146 0.05
147 0.06
148 0.06
149 0.07
150 0.08
151 0.07
152 0.11
153 0.11
154 0.12
155 0.12
156 0.14
157 0.13
158 0.14
159 0.15
160 0.12
161 0.13
162 0.13
163 0.12
164 0.11
165 0.12
166 0.12
167 0.14
168 0.13
169 0.13
170 0.13
171 0.13
172 0.14
173 0.13
174 0.13
175 0.1
176 0.09
177 0.09
178 0.1
179 0.12
180 0.11
181 0.1
182 0.09
183 0.09
184 0.09
185 0.09
186 0.08
187 0.06
188 0.06
189 0.08
190 0.14
191 0.16
192 0.21
193 0.29
194 0.38
195 0.48
196 0.59
197 0.66
198 0.71
199 0.78
200 0.8
201 0.79
202 0.8
203 0.79
204 0.72
205 0.69
206 0.6
207 0.59
208 0.54
209 0.5
210 0.43
211 0.34
212 0.3
213 0.24
214 0.24
215 0.16
216 0.15
217 0.11
218 0.1
219 0.1
220 0.11
221 0.13
222 0.14