Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4V9A2

Protein Details
Accession C4V9A2    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
104-130DDKLRLKKLKKSIHNKFYKKKRKITVSBasic
NLS Segment(s)
PositionSequence
108-126RLKKLKKSIHNKFYKKKRK
Subcellular Location(s) nucl 18, cyto_nucl 13, cyto 6
Family & Domain DBs
KEGG nce:NCER_101125  -  
Amino Acid Sequences MDKKVDYSFPEALKNTINTNINKFKNTGVDKNTSEMLKCPSMMSYPDFTHLFFAPHCNTICCAEQELSDLFNKLEENFYNLVQARNLPEFSNIYNIDASNISDDDKLRLKKLKKSIHNKFYKKKRKITVSISNIYKQLRYQQISEQSYNLIEKVLKFTSQVFAFITDSNFFIRKKFFTSYFFDDRFKYQKYKFTTLFSDKNFAKMITLVERVLYQDRHFDHVKGVDLKRNLKYLANHILDITINLDSFTNSLEVLYKFYIKFKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.31
3 0.32
4 0.36
5 0.34
6 0.41
7 0.48
8 0.47
9 0.48
10 0.46
11 0.42
12 0.45
13 0.49
14 0.48
15 0.45
16 0.48
17 0.47
18 0.49
19 0.49
20 0.41
21 0.36
22 0.31
23 0.3
24 0.25
25 0.24
26 0.22
27 0.2
28 0.21
29 0.22
30 0.23
31 0.22
32 0.21
33 0.24
34 0.24
35 0.23
36 0.24
37 0.22
38 0.2
39 0.16
40 0.21
41 0.19
42 0.22
43 0.22
44 0.21
45 0.22
46 0.23
47 0.25
48 0.21
49 0.21
50 0.18
51 0.17
52 0.19
53 0.18
54 0.16
55 0.15
56 0.14
57 0.11
58 0.12
59 0.12
60 0.1
61 0.12
62 0.11
63 0.14
64 0.15
65 0.15
66 0.18
67 0.18
68 0.19
69 0.16
70 0.17
71 0.16
72 0.17
73 0.18
74 0.15
75 0.16
76 0.16
77 0.17
78 0.2
79 0.18
80 0.17
81 0.16
82 0.16
83 0.15
84 0.14
85 0.13
86 0.09
87 0.09
88 0.09
89 0.09
90 0.1
91 0.11
92 0.17
93 0.18
94 0.2
95 0.27
96 0.3
97 0.36
98 0.45
99 0.52
100 0.56
101 0.65
102 0.72
103 0.76
104 0.82
105 0.83
106 0.83
107 0.85
108 0.86
109 0.84
110 0.82
111 0.8
112 0.79
113 0.77
114 0.77
115 0.76
116 0.72
117 0.69
118 0.63
119 0.56
120 0.5
121 0.43
122 0.35
123 0.25
124 0.25
125 0.25
126 0.25
127 0.25
128 0.27
129 0.35
130 0.38
131 0.38
132 0.32
133 0.26
134 0.25
135 0.24
136 0.19
137 0.11
138 0.08
139 0.08
140 0.11
141 0.11
142 0.11
143 0.11
144 0.12
145 0.15
146 0.15
147 0.16
148 0.12
149 0.13
150 0.14
151 0.14
152 0.14
153 0.11
154 0.11
155 0.12
156 0.14
157 0.12
158 0.13
159 0.15
160 0.16
161 0.19
162 0.22
163 0.24
164 0.26
165 0.32
166 0.38
167 0.42
168 0.43
169 0.4
170 0.38
171 0.4
172 0.41
173 0.38
174 0.38
175 0.35
176 0.4
177 0.46
178 0.52
179 0.5
180 0.49
181 0.53
182 0.53
183 0.56
184 0.51
185 0.5
186 0.43
187 0.43
188 0.4
189 0.32
190 0.26
191 0.21
192 0.22
193 0.19
194 0.21
195 0.17
196 0.17
197 0.17
198 0.18
199 0.21
200 0.2
201 0.17
202 0.22
203 0.23
204 0.28
205 0.29
206 0.28
207 0.28
208 0.29
209 0.34
210 0.35
211 0.36
212 0.38
213 0.42
214 0.48
215 0.47
216 0.48
217 0.44
218 0.42
219 0.43
220 0.43
221 0.48
222 0.44
223 0.4
224 0.36
225 0.36
226 0.31
227 0.28
228 0.22
229 0.12
230 0.1
231 0.1
232 0.1
233 0.09
234 0.09
235 0.1
236 0.08
237 0.07
238 0.08
239 0.11
240 0.11
241 0.14
242 0.16
243 0.19
244 0.2