Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C4V8F5

Protein Details
Accession C4V8F5    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-33MGINHRGEHKRKKSGGKSVLHRKKRNNRSGSQMBasic
NLS Segment(s)
PositionSequence
6-31RGEHKRKKSGGKSVLHRKKRNNRSGS
42-55KVVEKRARGGNKKY
Subcellular Location(s) nucl 23, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR001047  Ribosomal_S8e  
IPR022309  Ribosomal_S8e/biogenesis_NSA2  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG nce:NCER_100772  -  
Pfam View protein in Pfam  
PF01201  Ribosomal_S8e  
CDD cd11382  Ribosomal_S8e  
Amino Acid Sequences MGINHRGEHKRKKSGGKSVLHRKKRNNRSGSQMAATKIGDTKVVEKRARGGNKKYKALRLSEGTFLLKSSDTVKPSKIIEVMYHPTNNDYVRTNTITKSSVVKISSDNFSEEISSLNVEDPKLKESFEKGYLYAVITSRPGQVGKAEGEILQGRQLEFYTALFKKNKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.84
3 0.82
4 0.83
5 0.84
6 0.87
7 0.86
8 0.86
9 0.86
10 0.87
11 0.89
12 0.9
13 0.87
14 0.81
15 0.8
16 0.79
17 0.72
18 0.66
19 0.58
20 0.49
21 0.43
22 0.38
23 0.3
24 0.24
25 0.2
26 0.17
27 0.15
28 0.2
29 0.24
30 0.32
31 0.32
32 0.31
33 0.36
34 0.43
35 0.51
36 0.52
37 0.55
38 0.58
39 0.64
40 0.71
41 0.7
42 0.68
43 0.63
44 0.6
45 0.55
46 0.5
47 0.44
48 0.39
49 0.36
50 0.3
51 0.26
52 0.22
53 0.18
54 0.13
55 0.11
56 0.12
57 0.14
58 0.15
59 0.17
60 0.18
61 0.19
62 0.19
63 0.2
64 0.18
65 0.15
66 0.13
67 0.16
68 0.18
69 0.18
70 0.18
71 0.16
72 0.16
73 0.17
74 0.16
75 0.13
76 0.12
77 0.12
78 0.15
79 0.18
80 0.18
81 0.17
82 0.19
83 0.19
84 0.18
85 0.19
86 0.18
87 0.19
88 0.18
89 0.18
90 0.18
91 0.2
92 0.21
93 0.19
94 0.18
95 0.15
96 0.15
97 0.15
98 0.12
99 0.11
100 0.09
101 0.08
102 0.07
103 0.08
104 0.09
105 0.09
106 0.12
107 0.12
108 0.15
109 0.15
110 0.15
111 0.15
112 0.18
113 0.22
114 0.23
115 0.24
116 0.22
117 0.23
118 0.23
119 0.22
120 0.21
121 0.16
122 0.13
123 0.14
124 0.15
125 0.14
126 0.15
127 0.15
128 0.14
129 0.15
130 0.17
131 0.17
132 0.17
133 0.17
134 0.15
135 0.18
136 0.18
137 0.17
138 0.18
139 0.17
140 0.16
141 0.16
142 0.16
143 0.15
144 0.14
145 0.15
146 0.19
147 0.19
148 0.25