Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4V7I4

Protein Details
Accession C4V7I4   
Localization Confidence High
Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
44-66GIKAKLFTKKRRNEKIQLKKILIHydrophilic
NLS Segment(s)
PositionSequence
23-73KKLKKEARADAILGRKIKKLHGIKAKLFTKKRRNEKIQLKKILILKKIKTK
Subcellular Location(s) nucl 20, mito 4, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR039411  NSA2_fam  
KEGG nce:NCER_100415  -  
Amino Acid Sequences MPQNNFVEQHIKKYGRQLDYEVKKLKKEARADAILGRKIKKLHGIKAKLFTKKRRNEKIQLKKILILKKIKTKISSLKMKVIPFHISYLIENYNNKEKNLIIKLNNRDKIEQQNIQYPFQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.48
3 0.5
4 0.49
5 0.51
6 0.55
7 0.61
8 0.6
9 0.54
10 0.53
11 0.56
12 0.56
13 0.54
14 0.53
15 0.52
16 0.52
17 0.51
18 0.5
19 0.5
20 0.49
21 0.47
22 0.43
23 0.38
24 0.33
25 0.32
26 0.32
27 0.36
28 0.35
29 0.39
30 0.46
31 0.5
32 0.51
33 0.59
34 0.63
35 0.62
36 0.63
37 0.65
38 0.65
39 0.68
40 0.74
41 0.75
42 0.77
43 0.78
44 0.83
45 0.84
46 0.83
47 0.81
48 0.71
49 0.66
50 0.64
51 0.59
52 0.54
53 0.49
54 0.43
55 0.46
56 0.5
57 0.49
58 0.46
59 0.45
60 0.48
61 0.5
62 0.55
63 0.49
64 0.52
65 0.53
66 0.52
67 0.5
68 0.45
69 0.4
70 0.32
71 0.31
72 0.25
73 0.21
74 0.2
75 0.21
76 0.21
77 0.2
78 0.2
79 0.22
80 0.29
81 0.3
82 0.3
83 0.28
84 0.26
85 0.32
86 0.38
87 0.4
88 0.38
89 0.45
90 0.54
91 0.63
92 0.68
93 0.63
94 0.6
95 0.58
96 0.62
97 0.62
98 0.58
99 0.52
100 0.54
101 0.55