Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4V995

Protein Details
Accession C4V995   
Localization Confidence Low
Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
2-24SAGGYRRKTRQLLKQPFRKHGTPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, nucl 10, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR036948  Ribosomal_L21_sf  
IPR001147  Ribosomal_L21e  
IPR018259  Ribosomal_L21e_CS  
IPR008991  Translation_prot_SH3-like_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG nce:NCER_101112  -  
Pfam View protein in Pfam  
PF01157  Ribosomal_L21e  
PROSITE View protein in PROSITE  
PS01171  RIBOSOMAL_L21E  
Amino Acid Sequences MSAGGYRRKTRQLLKQPFRKHGTPGLSVYLATYRIGDYVTININPSIHKGMPFKYYHGRTGRVFTVNPKSVGVVLHKKVNGRLSVKTIFVRVEHLKRYKGRDAFLERVKKNREILEEARKNGVKPEYIRQKEEGPREEFVLDLSKNVPVKVAYEPFIKIY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.84
3 0.84
4 0.86
5 0.84
6 0.76
7 0.7
8 0.67
9 0.62
10 0.56
11 0.5
12 0.45
13 0.38
14 0.35
15 0.31
16 0.24
17 0.19
18 0.15
19 0.13
20 0.09
21 0.09
22 0.09
23 0.09
24 0.08
25 0.1
26 0.12
27 0.12
28 0.12
29 0.13
30 0.13
31 0.13
32 0.15
33 0.16
34 0.14
35 0.17
36 0.19
37 0.21
38 0.26
39 0.27
40 0.28
41 0.33
42 0.35
43 0.39
44 0.4
45 0.42
46 0.37
47 0.4
48 0.39
49 0.33
50 0.31
51 0.29
52 0.34
53 0.32
54 0.32
55 0.28
56 0.25
57 0.23
58 0.23
59 0.23
60 0.2
61 0.19
62 0.22
63 0.23
64 0.24
65 0.26
66 0.28
67 0.28
68 0.24
69 0.24
70 0.25
71 0.26
72 0.27
73 0.24
74 0.22
75 0.19
76 0.16
77 0.2
78 0.2
79 0.22
80 0.27
81 0.3
82 0.34
83 0.38
84 0.44
85 0.46
86 0.45
87 0.43
88 0.44
89 0.47
90 0.48
91 0.52
92 0.55
93 0.49
94 0.53
95 0.56
96 0.52
97 0.49
98 0.47
99 0.44
100 0.41
101 0.46
102 0.5
103 0.51
104 0.49
105 0.51
106 0.48
107 0.44
108 0.42
109 0.39
110 0.33
111 0.31
112 0.39
113 0.44
114 0.47
115 0.5
116 0.48
117 0.53
118 0.55
119 0.6
120 0.57
121 0.5
122 0.48
123 0.47
124 0.44
125 0.36
126 0.3
127 0.27
128 0.2
129 0.17
130 0.16
131 0.19
132 0.2
133 0.2
134 0.21
135 0.15
136 0.18
137 0.23
138 0.26
139 0.24
140 0.26