Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4VBC1

Protein Details
Accession C4VBC1   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
101-125ATNCRKKGCGSKDLRPKKQLKAVKKHydrophilic
NLS Segment(s)
PositionSequence
114-125LRPKKQLKAVKK
Subcellular Location(s) nucl 14, mito 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR038587  L40e_sf  
IPR001975  Ribosomal_L40e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG nce:NCER_102067  -  
Pfam View protein in Pfam  
PF01020  Ribosomal_L40e  
Amino Acid Sequences MSIICKFNNKSSFYNLNTAFDLKVELSTKYNLNINDISLLCGTRFLEDTSILSVFNGQEVNAILKCVGGGNMLDENDRELANKRNKRLICRRCNVRLSVNATNCRKKGCGSKDLRPKKQLKAVKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.49
3 0.45
4 0.42
5 0.4
6 0.32
7 0.24
8 0.22
9 0.14
10 0.16
11 0.14
12 0.14
13 0.15
14 0.17
15 0.18
16 0.18
17 0.22
18 0.19
19 0.22
20 0.21
21 0.19
22 0.2
23 0.19
24 0.19
25 0.15
26 0.15
27 0.11
28 0.11
29 0.11
30 0.09
31 0.09
32 0.08
33 0.09
34 0.09
35 0.1
36 0.1
37 0.1
38 0.09
39 0.08
40 0.08
41 0.07
42 0.07
43 0.07
44 0.05
45 0.05
46 0.06
47 0.07
48 0.06
49 0.07
50 0.06
51 0.06
52 0.06
53 0.05
54 0.05
55 0.04
56 0.04
57 0.05
58 0.06
59 0.07
60 0.07
61 0.07
62 0.08
63 0.08
64 0.08
65 0.08
66 0.09
67 0.17
68 0.27
69 0.33
70 0.35
71 0.43
72 0.46
73 0.54
74 0.63
75 0.66
76 0.66
77 0.7
78 0.76
79 0.76
80 0.78
81 0.73
82 0.68
83 0.65
84 0.62
85 0.61
86 0.59
87 0.59
88 0.61
89 0.64
90 0.6
91 0.56
92 0.5
93 0.46
94 0.5
95 0.48
96 0.52
97 0.52
98 0.6
99 0.68
100 0.78
101 0.82
102 0.82
103 0.81
104 0.8
105 0.82