Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C4VAY5

Protein Details
Accession C4VAY5    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
216-237YAVAVSKKRKVRKFVCLKSWVYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto 7, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
KEGG nce:NCER_101890  -  
Amino Acid Sequences MATFNSLDISNIVSLSIFKQFEEALKTRHNNIIVISGPSGSLKTSLINTVLNKLSLVSEYITDVSVYKSKLLTKSSICLTDIDDLEYFIKHKHKINKMSNLIIETRLLPYMYKSLDNGIGINLSISNKNKKDKINYHLSPYKKLRSIEPLPCIYKTLNILFSNQSYKVTICYDYKILKYIFSNSLEFIELESLYNIYDSISLADLKLDEFIDYAVYAVAVSKKRKVRKFVCLKSWVYENHYVCTPLCFEYKKYF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.16
4 0.14
5 0.14
6 0.15
7 0.16
8 0.19
9 0.26
10 0.27
11 0.25
12 0.34
13 0.37
14 0.39
15 0.44
16 0.42
17 0.36
18 0.34
19 0.34
20 0.27
21 0.26
22 0.23
23 0.18
24 0.16
25 0.16
26 0.15
27 0.1
28 0.1
29 0.08
30 0.09
31 0.1
32 0.12
33 0.13
34 0.16
35 0.17
36 0.21
37 0.21
38 0.2
39 0.19
40 0.17
41 0.16
42 0.13
43 0.13
44 0.09
45 0.08
46 0.09
47 0.1
48 0.1
49 0.09
50 0.09
51 0.1
52 0.12
53 0.12
54 0.13
55 0.14
56 0.18
57 0.21
58 0.24
59 0.26
60 0.25
61 0.28
62 0.3
63 0.3
64 0.27
65 0.24
66 0.23
67 0.22
68 0.21
69 0.19
70 0.16
71 0.14
72 0.14
73 0.14
74 0.12
75 0.11
76 0.15
77 0.16
78 0.23
79 0.31
80 0.39
81 0.49
82 0.57
83 0.64
84 0.64
85 0.64
86 0.59
87 0.52
88 0.45
89 0.35
90 0.27
91 0.18
92 0.14
93 0.12
94 0.1
95 0.08
96 0.08
97 0.1
98 0.11
99 0.11
100 0.1
101 0.11
102 0.12
103 0.12
104 0.11
105 0.09
106 0.08
107 0.07
108 0.07
109 0.06
110 0.05
111 0.08
112 0.1
113 0.16
114 0.19
115 0.23
116 0.28
117 0.31
118 0.39
119 0.44
120 0.48
121 0.52
122 0.51
123 0.54
124 0.55
125 0.53
126 0.52
127 0.49
128 0.48
129 0.43
130 0.42
131 0.37
132 0.4
133 0.45
134 0.44
135 0.44
136 0.44
137 0.41
138 0.4
139 0.39
140 0.31
141 0.26
142 0.23
143 0.2
144 0.21
145 0.2
146 0.21
147 0.21
148 0.23
149 0.24
150 0.21
151 0.2
152 0.15
153 0.15
154 0.15
155 0.16
156 0.17
157 0.15
158 0.17
159 0.2
160 0.21
161 0.22
162 0.24
163 0.23
164 0.22
165 0.22
166 0.24
167 0.25
168 0.25
169 0.26
170 0.22
171 0.23
172 0.21
173 0.2
174 0.15
175 0.12
176 0.1
177 0.09
178 0.09
179 0.08
180 0.07
181 0.07
182 0.06
183 0.05
184 0.05
185 0.05
186 0.06
187 0.07
188 0.07
189 0.07
190 0.07
191 0.07
192 0.07
193 0.08
194 0.07
195 0.07
196 0.07
197 0.07
198 0.07
199 0.07
200 0.06
201 0.05
202 0.05
203 0.04
204 0.06
205 0.11
206 0.16
207 0.19
208 0.27
209 0.35
210 0.44
211 0.52
212 0.61
213 0.64
214 0.7
215 0.78
216 0.81
217 0.83
218 0.81
219 0.77
220 0.7
221 0.68
222 0.61
223 0.57
224 0.56
225 0.48
226 0.43
227 0.42
228 0.4
229 0.34
230 0.33
231 0.28
232 0.22
233 0.26
234 0.25