Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C4VA54

Protein Details
Accession C4VA54    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
19-44KEWHNQPSRALRRAKNRKMKAKALYPHydrophilic
NLS Segment(s)
PositionSequence
25-41PSRALRRAKNRKMKAKA
Subcellular Location(s) nucl 21.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001380  Ribosomal_L13e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG nce:NCER_101492  -  
Pfam View protein in Pfam  
PF01294  Ribosomal_L13e  
Amino Acid Sequences MKNNHILPNNHRNTMKRVKEWHNQPSRALRRAKNRKMKAKALYPAPLKKLCPIVRCPTIRYNKKQRLGKGFTPEELKEAGIEVNYARKIGIRVDTRRRNMNKETLDLNSQRVKEYLSKLTIFKNGKEAKESGVKQHKGIIMPVIRNKPQVELIEKSAIESYE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.63
3 0.6
4 0.63
5 0.65
6 0.71
7 0.77
8 0.79
9 0.78
10 0.73
11 0.71
12 0.73
13 0.73
14 0.71
15 0.69
16 0.66
17 0.67
18 0.75
19 0.8
20 0.8
21 0.82
22 0.85
23 0.84
24 0.86
25 0.83
26 0.8
27 0.76
28 0.7
29 0.68
30 0.65
31 0.62
32 0.59
33 0.54
34 0.47
35 0.43
36 0.47
37 0.44
38 0.41
39 0.42
40 0.43
41 0.48
42 0.49
43 0.5
44 0.5
45 0.55
46 0.59
47 0.62
48 0.67
49 0.68
50 0.74
51 0.76
52 0.73
53 0.73
54 0.72
55 0.67
56 0.65
57 0.57
58 0.5
59 0.49
60 0.42
61 0.33
62 0.27
63 0.22
64 0.13
65 0.12
66 0.1
67 0.06
68 0.06
69 0.05
70 0.07
71 0.07
72 0.07
73 0.07
74 0.08
75 0.08
76 0.1
77 0.16
78 0.2
79 0.27
80 0.37
81 0.45
82 0.47
83 0.56
84 0.58
85 0.57
86 0.56
87 0.58
88 0.51
89 0.46
90 0.45
91 0.38
92 0.39
93 0.34
94 0.33
95 0.29
96 0.27
97 0.25
98 0.23
99 0.23
100 0.23
101 0.27
102 0.28
103 0.27
104 0.29
105 0.3
106 0.32
107 0.38
108 0.35
109 0.32
110 0.36
111 0.38
112 0.37
113 0.39
114 0.38
115 0.34
116 0.4
117 0.41
118 0.41
119 0.46
120 0.46
121 0.43
122 0.47
123 0.47
124 0.39
125 0.39
126 0.37
127 0.32
128 0.36
129 0.43
130 0.45
131 0.44
132 0.47
133 0.47
134 0.42
135 0.43
136 0.42
137 0.4
138 0.37
139 0.39
140 0.41
141 0.39
142 0.38