Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4V6N0

Protein Details
Accession C4V6N0    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
31-50LLKRKSDSLKQKFKNIQKDLHydrophilic
NLS Segment(s)
PositionSequence
33-35KRK
Subcellular Location(s) nucl 14, cyto_nucl 9.5, mito 8, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002699  V_ATPase_D  
Gene Ontology GO:0046961  F:proton-transporting ATPase activity, rotational mechanism  
KEGG nce:NCER_100067  -  
Pfam View protein in Pfam  
PF01813  ATP-synt_D  
Amino Acid Sequences MADQRLPVFPTRMNLKIIDNKEKSAEKGRILLKRKSDSLKQKFKNIQKDLFEKKKDINQMLKDAFFKLSEAEYLGANVQSYIQECQKQPLYVKTSVEVISGVTLINFKLDKSNISNILWLDRSGQVLNECRNNFLNVVELLIELSALSNSFKILEHVLMSTNRRVNALEFSVIPKLQNTMSYINSELDEQDREEFFRLKKIQGLKNKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.37
3 0.43
4 0.47
5 0.52
6 0.48
7 0.47
8 0.5
9 0.5
10 0.48
11 0.48
12 0.47
13 0.39
14 0.44
15 0.49
16 0.52
17 0.55
18 0.58
19 0.57
20 0.58
21 0.61
22 0.6
23 0.63
24 0.65
25 0.69
26 0.74
27 0.7
28 0.74
29 0.77
30 0.79
31 0.8
32 0.76
33 0.73
34 0.69
35 0.73
36 0.73
37 0.73
38 0.68
39 0.6
40 0.57
41 0.56
42 0.57
43 0.55
44 0.53
45 0.48
46 0.52
47 0.51
48 0.49
49 0.43
50 0.37
51 0.32
52 0.24
53 0.2
54 0.13
55 0.12
56 0.1
57 0.1
58 0.09
59 0.08
60 0.08
61 0.08
62 0.07
63 0.07
64 0.06
65 0.05
66 0.05
67 0.06
68 0.08
69 0.1
70 0.14
71 0.14
72 0.18
73 0.2
74 0.21
75 0.22
76 0.27
77 0.29
78 0.28
79 0.29
80 0.25
81 0.25
82 0.24
83 0.22
84 0.16
85 0.1
86 0.08
87 0.07
88 0.06
89 0.04
90 0.04
91 0.04
92 0.05
93 0.05
94 0.05
95 0.07
96 0.08
97 0.1
98 0.13
99 0.16
100 0.18
101 0.18
102 0.2
103 0.17
104 0.19
105 0.18
106 0.15
107 0.13
108 0.12
109 0.13
110 0.11
111 0.12
112 0.12
113 0.15
114 0.18
115 0.22
116 0.21
117 0.23
118 0.24
119 0.24
120 0.22
121 0.18
122 0.18
123 0.12
124 0.12
125 0.1
126 0.08
127 0.07
128 0.06
129 0.06
130 0.03
131 0.04
132 0.03
133 0.03
134 0.04
135 0.04
136 0.04
137 0.05
138 0.06
139 0.07
140 0.08
141 0.09
142 0.09
143 0.1
144 0.13
145 0.15
146 0.18
147 0.22
148 0.24
149 0.24
150 0.24
151 0.24
152 0.23
153 0.25
154 0.24
155 0.21
156 0.18
157 0.2
158 0.23
159 0.22
160 0.21
161 0.16
162 0.16
163 0.15
164 0.17
165 0.18
166 0.18
167 0.2
168 0.22
169 0.23
170 0.22
171 0.22
172 0.2
173 0.18
174 0.17
175 0.17
176 0.16
177 0.17
178 0.17
179 0.18
180 0.21
181 0.24
182 0.23
183 0.31
184 0.32
185 0.31
186 0.37
187 0.44
188 0.5