Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4VB95

Protein Details
Accession C4VB95    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MKTPKKRVTLKTPKRSTKSTFKSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto_nucl 14, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR031519  DUF5094  
KEGG nce:NCER_102037  -  
Pfam View protein in Pfam  
PF17015  DUF5094  
Amino Acid Sequences MKTPKKRVTLKTPKRSTKSTFKSTGHTKGVKDESDSVTKKKDSPSKFIADLDIEIKNTENELITSLQKENELLRSTNLYVKFLGLDITQVGDKYVVKYNVNKDNRFLHFELVPEDDMYVYSLVRSENIDELGVLGDEISFEKEQIAKFFYKVMEIMISD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.85
3 0.81
4 0.81
5 0.79
6 0.76
7 0.75
8 0.67
9 0.68
10 0.69
11 0.69
12 0.66
13 0.61
14 0.54
15 0.53
16 0.56
17 0.49
18 0.45
19 0.41
20 0.37
21 0.41
22 0.43
23 0.37
24 0.37
25 0.37
26 0.37
27 0.4
28 0.45
29 0.41
30 0.45
31 0.49
32 0.49
33 0.49
34 0.46
35 0.4
36 0.33
37 0.29
38 0.24
39 0.19
40 0.14
41 0.12
42 0.12
43 0.1
44 0.1
45 0.09
46 0.07
47 0.06
48 0.07
49 0.09
50 0.09
51 0.1
52 0.11
53 0.11
54 0.11
55 0.11
56 0.11
57 0.13
58 0.14
59 0.13
60 0.13
61 0.15
62 0.15
63 0.19
64 0.18
65 0.15
66 0.14
67 0.13
68 0.13
69 0.11
70 0.1
71 0.06
72 0.06
73 0.05
74 0.05
75 0.06
76 0.05
77 0.05
78 0.06
79 0.06
80 0.08
81 0.13
82 0.14
83 0.16
84 0.2
85 0.27
86 0.36
87 0.42
88 0.4
89 0.39
90 0.43
91 0.45
92 0.46
93 0.41
94 0.34
95 0.29
96 0.29
97 0.27
98 0.23
99 0.2
100 0.14
101 0.13
102 0.11
103 0.1
104 0.1
105 0.08
106 0.06
107 0.05
108 0.06
109 0.06
110 0.07
111 0.08
112 0.09
113 0.1
114 0.11
115 0.11
116 0.1
117 0.1
118 0.1
119 0.09
120 0.07
121 0.05
122 0.04
123 0.04
124 0.05
125 0.08
126 0.08
127 0.08
128 0.1
129 0.13
130 0.14
131 0.17
132 0.2
133 0.18
134 0.19
135 0.22
136 0.21
137 0.21
138 0.2
139 0.19