Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4VA35

Protein Details
Accession C4VA35    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
256-279IKKLLECNKVQHDRHRKRAGENSDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 14.5, cyto 4.5
Family & Domain DBs
KEGG nce:NCER_101469  -  
Amino Acid Sequences MLYLLMLLAKTVCFSEDVDEQALESCGVNINPIMKRYASILENYLNKCYLSILNECRNKVYTKELIIEEKDYIIKMLQKIDEDGKDPSNVSKGIVKLIKELKSELEVTKNELSECKKKHDDKMQTCLNALKDKDASIIRIQEELQNKKKELCELLKNKMDKGKASESIVKENKQNKETISSLGDPSDVNDSKLSLSSKNVQIIALIKDLRKKLKFDCRNTLSSSKVCTKKSVPIQNYDEFTYSNGSFNKSYKEILIKKLLECNKVQHDRHRKRAGENSDEENDGDLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.13
3 0.14
4 0.17
5 0.18
6 0.18
7 0.17
8 0.17
9 0.17
10 0.14
11 0.11
12 0.09
13 0.1
14 0.1
15 0.1
16 0.1
17 0.15
18 0.17
19 0.19
20 0.21
21 0.19
22 0.2
23 0.21
24 0.25
25 0.21
26 0.21
27 0.23
28 0.26
29 0.32
30 0.33
31 0.33
32 0.29
33 0.27
34 0.25
35 0.24
36 0.21
37 0.18
38 0.23
39 0.28
40 0.36
41 0.41
42 0.42
43 0.43
44 0.43
45 0.41
46 0.36
47 0.36
48 0.32
49 0.3
50 0.34
51 0.33
52 0.35
53 0.35
54 0.34
55 0.28
56 0.24
57 0.22
58 0.17
59 0.15
60 0.12
61 0.14
62 0.14
63 0.17
64 0.18
65 0.18
66 0.2
67 0.24
68 0.24
69 0.22
70 0.23
71 0.21
72 0.2
73 0.2
74 0.19
75 0.17
76 0.16
77 0.15
78 0.16
79 0.15
80 0.2
81 0.22
82 0.21
83 0.24
84 0.3
85 0.33
86 0.3
87 0.3
88 0.26
89 0.26
90 0.27
91 0.23
92 0.22
93 0.18
94 0.22
95 0.23
96 0.22
97 0.2
98 0.22
99 0.25
100 0.28
101 0.3
102 0.33
103 0.39
104 0.43
105 0.5
106 0.56
107 0.62
108 0.59
109 0.65
110 0.63
111 0.56
112 0.52
113 0.48
114 0.4
115 0.34
116 0.29
117 0.23
118 0.18
119 0.18
120 0.2
121 0.17
122 0.17
123 0.15
124 0.17
125 0.15
126 0.15
127 0.15
128 0.17
129 0.22
130 0.27
131 0.32
132 0.33
133 0.33
134 0.35
135 0.35
136 0.34
137 0.33
138 0.31
139 0.33
140 0.35
141 0.41
142 0.44
143 0.44
144 0.43
145 0.42
146 0.39
147 0.31
148 0.31
149 0.3
150 0.27
151 0.3
152 0.33
153 0.31
154 0.38
155 0.4
156 0.36
157 0.38
158 0.42
159 0.45
160 0.41
161 0.41
162 0.33
163 0.35
164 0.34
165 0.3
166 0.27
167 0.23
168 0.21
169 0.2
170 0.19
171 0.14
172 0.14
173 0.18
174 0.15
175 0.14
176 0.14
177 0.14
178 0.14
179 0.17
180 0.17
181 0.12
182 0.15
183 0.19
184 0.22
185 0.25
186 0.25
187 0.22
188 0.22
189 0.23
190 0.22
191 0.2
192 0.18
193 0.17
194 0.22
195 0.26
196 0.33
197 0.34
198 0.35
199 0.4
200 0.5
201 0.58
202 0.61
203 0.68
204 0.65
205 0.66
206 0.68
207 0.63
208 0.57
209 0.5
210 0.47
211 0.45
212 0.47
213 0.44
214 0.44
215 0.43
216 0.48
217 0.55
218 0.6
219 0.54
220 0.57
221 0.61
222 0.61
223 0.6
224 0.53
225 0.45
226 0.35
227 0.32
228 0.28
229 0.23
230 0.22
231 0.2
232 0.22
233 0.23
234 0.25
235 0.29
236 0.26
237 0.27
238 0.27
239 0.36
240 0.37
241 0.41
242 0.48
243 0.46
244 0.46
245 0.53
246 0.55
247 0.5
248 0.48
249 0.49
250 0.5
251 0.57
252 0.59
253 0.61
254 0.66
255 0.72
256 0.8
257 0.83
258 0.77
259 0.76
260 0.82
261 0.8
262 0.77
263 0.73
264 0.69
265 0.62
266 0.59
267 0.5