Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4V7T7

Protein Details
Accession C4V7T7   
Localization Confidence Medium
Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
162-186DDEQPFYPKIKKKKQKINNLVRAEEHydrophilic
NLS Segment(s)
PositionSequence
172-175KKKK
Subcellular Location(s) nucl 18.5, cyto_nucl 12, cyto 4.5, mito 2
Family & Domain DBs
KEGG nce:NCER_100528  -  
Amino Acid Sequences MYILLFAYVVNTKKVSLYSPFLQLRELDIGQNIGEVVPSKDLKNEFILNITDQNLAQNLKISNLRVHHDILGYQIYNYSGCLTANNSGLNIEQCVDIQSSKIIFQRFKFVDSSENEQKSKKREPEEDFEKLSEAPYAGKVSNPRPPVLFSKAENNYNFLNEDDEQPFYPKIKKKKQKINNLVRAEEAPEKLDEDELLHLNGKNTEIEDQLNNFLSKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.21
4 0.26
5 0.27
6 0.35
7 0.38
8 0.37
9 0.37
10 0.34
11 0.32
12 0.31
13 0.29
14 0.21
15 0.18
16 0.18
17 0.16
18 0.16
19 0.13
20 0.07
21 0.07
22 0.07
23 0.08
24 0.11
25 0.13
26 0.13
27 0.17
28 0.19
29 0.21
30 0.24
31 0.25
32 0.21
33 0.22
34 0.23
35 0.2
36 0.21
37 0.2
38 0.17
39 0.15
40 0.15
41 0.15
42 0.14
43 0.12
44 0.14
45 0.13
46 0.14
47 0.17
48 0.17
49 0.19
50 0.21
51 0.24
52 0.23
53 0.24
54 0.23
55 0.21
56 0.2
57 0.18
58 0.17
59 0.14
60 0.12
61 0.11
62 0.1
63 0.09
64 0.09
65 0.09
66 0.07
67 0.07
68 0.07
69 0.08
70 0.1
71 0.12
72 0.11
73 0.1
74 0.1
75 0.11
76 0.1
77 0.09
78 0.07
79 0.06
80 0.06
81 0.07
82 0.07
83 0.07
84 0.06
85 0.07
86 0.07
87 0.09
88 0.12
89 0.13
90 0.15
91 0.15
92 0.24
93 0.23
94 0.24
95 0.23
96 0.21
97 0.24
98 0.25
99 0.31
100 0.3
101 0.33
102 0.32
103 0.34
104 0.36
105 0.37
106 0.42
107 0.42
108 0.4
109 0.46
110 0.5
111 0.56
112 0.6
113 0.58
114 0.51
115 0.45
116 0.4
117 0.32
118 0.27
119 0.19
120 0.12
121 0.08
122 0.08
123 0.1
124 0.09
125 0.11
126 0.15
127 0.18
128 0.24
129 0.26
130 0.25
131 0.24
132 0.28
133 0.31
134 0.33
135 0.32
136 0.27
137 0.34
138 0.38
139 0.43
140 0.4
141 0.37
142 0.33
143 0.31
144 0.3
145 0.21
146 0.21
147 0.16
148 0.19
149 0.17
150 0.18
151 0.18
152 0.2
153 0.2
154 0.19
155 0.26
156 0.29
157 0.39
158 0.48
159 0.57
160 0.65
161 0.75
162 0.83
163 0.87
164 0.91
165 0.92
166 0.91
167 0.87
168 0.78
169 0.69
170 0.6
171 0.53
172 0.46
173 0.36
174 0.27
175 0.22
176 0.22
177 0.2
178 0.2
179 0.16
180 0.13
181 0.15
182 0.14
183 0.15
184 0.16
185 0.16
186 0.17
187 0.18
188 0.18
189 0.16
190 0.16
191 0.17
192 0.17
193 0.19
194 0.2
195 0.21
196 0.24
197 0.26