Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C4VC89

Protein Details
Accession C4VC89    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
161-180DDTFTYNRKRWKSSCRREIKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, cyto 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR036691  Endo/exonu/phosph_ase_sf  
KEGG nce:NCER_102600  -  
Amino Acid Sequences MTLVRKGGAIRCSKKGNDDNILQTVVEIKTSTGWIKILVINVYVPQERELKQLTLVNVINLLNVEKNKRCYKEIIVMGDMNVKDSTLKEKLVAGGLNPLINYNRVLGTRILSNGSVSKRRIDTIFRVLIQDSEKITISRRWSVGDHLLLRRKIILPSPIADDTFTYNRKRWKSSCRREIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.6
3 0.6
4 0.56
5 0.56
6 0.54
7 0.5
8 0.49
9 0.4
10 0.32
11 0.28
12 0.22
13 0.17
14 0.13
15 0.1
16 0.1
17 0.13
18 0.14
19 0.11
20 0.11
21 0.11
22 0.13
23 0.14
24 0.15
25 0.14
26 0.14
27 0.13
28 0.14
29 0.16
30 0.15
31 0.14
32 0.13
33 0.17
34 0.17
35 0.21
36 0.22
37 0.2
38 0.22
39 0.25
40 0.23
41 0.24
42 0.23
43 0.2
44 0.18
45 0.18
46 0.15
47 0.12
48 0.12
49 0.09
50 0.1
51 0.14
52 0.16
53 0.22
54 0.28
55 0.31
56 0.33
57 0.34
58 0.37
59 0.41
60 0.41
61 0.38
62 0.33
63 0.3
64 0.29
65 0.29
66 0.24
67 0.18
68 0.13
69 0.11
70 0.09
71 0.09
72 0.13
73 0.11
74 0.12
75 0.11
76 0.11
77 0.12
78 0.13
79 0.13
80 0.09
81 0.1
82 0.1
83 0.1
84 0.09
85 0.09
86 0.08
87 0.09
88 0.09
89 0.07
90 0.08
91 0.08
92 0.1
93 0.1
94 0.11
95 0.11
96 0.12
97 0.12
98 0.11
99 0.11
100 0.14
101 0.17
102 0.21
103 0.2
104 0.24
105 0.24
106 0.25
107 0.27
108 0.27
109 0.29
110 0.32
111 0.34
112 0.31
113 0.31
114 0.3
115 0.3
116 0.27
117 0.24
118 0.17
119 0.15
120 0.15
121 0.15
122 0.17
123 0.2
124 0.23
125 0.25
126 0.25
127 0.26
128 0.27
129 0.31
130 0.34
131 0.36
132 0.36
133 0.38
134 0.45
135 0.43
136 0.42
137 0.41
138 0.37
139 0.33
140 0.33
141 0.32
142 0.27
143 0.28
144 0.33
145 0.32
146 0.3
147 0.28
148 0.24
149 0.25
150 0.28
151 0.31
152 0.3
153 0.33
154 0.41
155 0.47
156 0.55
157 0.57
158 0.62
159 0.69
160 0.76