Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C4V8V4

Protein Details
Accession C4V8V4    Localization Confidence Low Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MENLFRKHEKKLRKVNSQEKILKSHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 19, nucl 4, E.R. 2, mito_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR004728  Sec62  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0015031  P:protein transport  
KEGG nce:NCER_100953  -  
Pfam View protein in Pfam  
PF03839  Sec62  
Amino Acid Sequences MENLFRKHEKKLRKVNSQEKILKSVKRVNVFKGADFIKILESLEFSKDTIKEFIIYLLVNSIILKVQVNDKNKNCDLLLDYRYSEKDYYIWSEEKSSHFSLLIVFGIIFLGLALGMFQMWPSNLKFLASYASYLCGAFIAFLLLLGVIRLIIFSITYFTHSPGIWLFPNLFADCGFVDSFIPLWCYHGENVKKEKFE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.87
3 0.88
4 0.88
5 0.86
6 0.78
7 0.76
8 0.72
9 0.65
10 0.61
11 0.61
12 0.58
13 0.6
14 0.59
15 0.56
16 0.59
17 0.57
18 0.51
19 0.48
20 0.42
21 0.34
22 0.31
23 0.27
24 0.18
25 0.17
26 0.17
27 0.11
28 0.11
29 0.11
30 0.12
31 0.12
32 0.11
33 0.14
34 0.15
35 0.17
36 0.17
37 0.16
38 0.15
39 0.15
40 0.15
41 0.13
42 0.12
43 0.09
44 0.08
45 0.08
46 0.07
47 0.07
48 0.06
49 0.05
50 0.06
51 0.06
52 0.06
53 0.13
54 0.19
55 0.24
56 0.32
57 0.35
58 0.41
59 0.42
60 0.43
61 0.36
62 0.31
63 0.29
64 0.26
65 0.26
66 0.2
67 0.2
68 0.2
69 0.2
70 0.21
71 0.18
72 0.13
73 0.12
74 0.12
75 0.15
76 0.16
77 0.16
78 0.15
79 0.16
80 0.18
81 0.18
82 0.21
83 0.18
84 0.16
85 0.15
86 0.14
87 0.13
88 0.12
89 0.1
90 0.06
91 0.05
92 0.04
93 0.04
94 0.04
95 0.03
96 0.02
97 0.02
98 0.02
99 0.02
100 0.02
101 0.02
102 0.02
103 0.02
104 0.02
105 0.03
106 0.03
107 0.05
108 0.06
109 0.08
110 0.08
111 0.08
112 0.09
113 0.09
114 0.11
115 0.1
116 0.1
117 0.09
118 0.11
119 0.11
120 0.1
121 0.1
122 0.07
123 0.07
124 0.06
125 0.05
126 0.04
127 0.04
128 0.04
129 0.04
130 0.03
131 0.03
132 0.03
133 0.03
134 0.02
135 0.02
136 0.02
137 0.03
138 0.03
139 0.03
140 0.03
141 0.05
142 0.06
143 0.09
144 0.1
145 0.12
146 0.14
147 0.14
148 0.15
149 0.14
150 0.17
151 0.15
152 0.16
153 0.15
154 0.15
155 0.19
156 0.18
157 0.17
158 0.14
159 0.15
160 0.13
161 0.15
162 0.13
163 0.1
164 0.1
165 0.1
166 0.11
167 0.1
168 0.11
169 0.09
170 0.11
171 0.12
172 0.15
173 0.16
174 0.25
175 0.3
176 0.37
177 0.46