Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4VBX9

Protein Details
Accession C4VBX9    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
13-40ALKAASTSKKEKKKWTEIKKKDEARKIFHydrophilic
NLS Segment(s)
PositionSequence
9-37KEKKALKAASTSKKEKKKWTEIKKKDEAR
Subcellular Location(s) nucl 20.5, cyto_nucl 12, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
KEGG nce:NCER_102385  -  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAKKVQETKEKKALKAASTSKKEKKKWTEIKKKDEARKIFTVSDELLQKVEKEVKKAKIVTVFSLGSKMNLTLSVAKNLLRHCVNNGIISLIHKSSKTTIYG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.57
3 0.58
4 0.58
5 0.61
6 0.68
7 0.69
8 0.73
9 0.76
10 0.77
11 0.78
12 0.79
13 0.82
14 0.84
15 0.86
16 0.86
17 0.89
18 0.89
19 0.88
20 0.85
21 0.84
22 0.78
23 0.73
24 0.68
25 0.62
26 0.53
27 0.44
28 0.38
29 0.29
30 0.27
31 0.21
32 0.16
33 0.14
34 0.13
35 0.12
36 0.11
37 0.17
38 0.15
39 0.19
40 0.25
41 0.28
42 0.33
43 0.34
44 0.35
45 0.35
46 0.36
47 0.33
48 0.3
49 0.27
50 0.22
51 0.23
52 0.21
53 0.15
54 0.14
55 0.12
56 0.08
57 0.08
58 0.1
59 0.13
60 0.15
61 0.17
62 0.18
63 0.19
64 0.22
65 0.23
66 0.27
67 0.24
68 0.24
69 0.23
70 0.3
71 0.3
72 0.29
73 0.28
74 0.24
75 0.22
76 0.22
77 0.23
78 0.17
79 0.18
80 0.17
81 0.19
82 0.21