Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4V7F2

Protein Details
Accession C4V7F2   
Localization Confidence Low
Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
304-330SYFSPDYKFNPKFKKKVADKNSKEYLDHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 15.5, cyto_nucl 14.5, nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000286  His_deacetylse  
IPR003084  His_deacetylse_1  
IPR023801  His_deacetylse_dom  
IPR037138  His_deacetylse_dom_sf  
IPR023696  Ureohydrolase_dom_sf  
Gene Ontology GO:0004407  F:histone deacetylase activity  
GO:0046872  F:metal ion binding  
GO:0016575  P:histone deacetylation  
GO:0006355  P:regulation of DNA-templated transcription  
KEGG nce:NCER_100381  -  
Pfam View protein in Pfam  
PF00850  Hist_deacetyl  
Amino Acid Sequences MKIGYMFDETVGLYHYGPKHPMKPFRIMVTHSLVKSMKLENKITVLKPQLEKLKYHTESYFKQLGKNETSDCPDFFGLQEFCHKYYSASINAARYINNKQFDVVINWAGGLHHAHKNEPSGFCYVNDIVMAILELLKYNEKVMYIDIDVHHGDGVEDAFLLNDRVLTLSFHKFGNGFFPETGSLVTSNYKAVNVPLLSGISDEGYQYIFEPIVDECIKKFKPNVIVMQCGADSLGADRLGVFNLSVYGHASCVRLVKNYNIPLIVLGGGGYTLCNVARCWAYETAILCGEEFCDDIPEDNQFYSYFSPDYKFNPKFKKKVADKNSKEYLDCISEFICERINKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.18
3 0.21
4 0.27
5 0.33
6 0.39
7 0.46
8 0.56
9 0.55
10 0.61
11 0.62
12 0.63
13 0.63
14 0.58
15 0.55
16 0.53
17 0.54
18 0.45
19 0.45
20 0.39
21 0.35
22 0.35
23 0.36
24 0.35
25 0.35
26 0.38
27 0.35
28 0.41
29 0.45
30 0.43
31 0.43
32 0.42
33 0.43
34 0.42
35 0.46
36 0.49
37 0.46
38 0.47
39 0.46
40 0.51
41 0.47
42 0.48
43 0.46
44 0.43
45 0.44
46 0.49
47 0.5
48 0.4
49 0.42
50 0.44
51 0.46
52 0.44
53 0.45
54 0.41
55 0.37
56 0.42
57 0.39
58 0.34
59 0.31
60 0.27
61 0.24
62 0.21
63 0.23
64 0.18
65 0.17
66 0.24
67 0.23
68 0.24
69 0.25
70 0.25
71 0.2
72 0.25
73 0.28
74 0.24
75 0.26
76 0.27
77 0.27
78 0.3
79 0.3
80 0.25
81 0.24
82 0.28
83 0.3
84 0.3
85 0.29
86 0.26
87 0.27
88 0.28
89 0.27
90 0.23
91 0.18
92 0.15
93 0.14
94 0.14
95 0.12
96 0.11
97 0.1
98 0.11
99 0.14
100 0.14
101 0.16
102 0.17
103 0.22
104 0.25
105 0.25
106 0.23
107 0.22
108 0.22
109 0.21
110 0.24
111 0.2
112 0.16
113 0.14
114 0.12
115 0.09
116 0.08
117 0.08
118 0.03
119 0.03
120 0.03
121 0.03
122 0.04
123 0.05
124 0.06
125 0.06
126 0.07
127 0.07
128 0.07
129 0.08
130 0.09
131 0.08
132 0.1
133 0.09
134 0.11
135 0.11
136 0.11
137 0.1
138 0.08
139 0.08
140 0.06
141 0.06
142 0.04
143 0.03
144 0.03
145 0.03
146 0.03
147 0.04
148 0.03
149 0.03
150 0.03
151 0.04
152 0.04
153 0.05
154 0.08
155 0.1
156 0.11
157 0.11
158 0.12
159 0.12
160 0.11
161 0.16
162 0.14
163 0.14
164 0.13
165 0.13
166 0.13
167 0.13
168 0.13
169 0.09
170 0.07
171 0.07
172 0.08
173 0.07
174 0.08
175 0.08
176 0.08
177 0.08
178 0.08
179 0.1
180 0.09
181 0.09
182 0.09
183 0.09
184 0.08
185 0.08
186 0.08
187 0.05
188 0.05
189 0.05
190 0.05
191 0.05
192 0.05
193 0.05
194 0.06
195 0.05
196 0.05
197 0.06
198 0.06
199 0.1
200 0.1
201 0.1
202 0.1
203 0.17
204 0.18
205 0.19
206 0.21
207 0.22
208 0.29
209 0.33
210 0.41
211 0.37
212 0.4
213 0.38
214 0.38
215 0.32
216 0.24
217 0.2
218 0.12
219 0.08
220 0.06
221 0.08
222 0.06
223 0.06
224 0.06
225 0.07
226 0.07
227 0.07
228 0.06
229 0.04
230 0.05
231 0.06
232 0.06
233 0.07
234 0.07
235 0.08
236 0.09
237 0.1
238 0.1
239 0.13
240 0.14
241 0.16
242 0.18
243 0.22
244 0.28
245 0.31
246 0.32
247 0.28
248 0.27
249 0.25
250 0.24
251 0.19
252 0.11
253 0.07
254 0.05
255 0.05
256 0.05
257 0.04
258 0.03
259 0.04
260 0.05
261 0.06
262 0.06
263 0.09
264 0.1
265 0.12
266 0.16
267 0.17
268 0.18
269 0.21
270 0.22
271 0.21
272 0.22
273 0.21
274 0.17
275 0.15
276 0.14
277 0.12
278 0.11
279 0.08
280 0.08
281 0.08
282 0.1
283 0.11
284 0.13
285 0.14
286 0.14
287 0.15
288 0.13
289 0.15
290 0.15
291 0.16
292 0.15
293 0.15
294 0.17
295 0.19
296 0.25
297 0.33
298 0.39
299 0.46
300 0.56
301 0.64
302 0.7
303 0.76
304 0.81
305 0.81
306 0.85
307 0.87
308 0.87
309 0.85
310 0.85
311 0.86
312 0.78
313 0.69
314 0.6
315 0.54
316 0.49
317 0.41
318 0.34
319 0.25
320 0.24
321 0.24
322 0.24
323 0.25