Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4V947

Protein Details
Accession C4V947   
Localization Confidence High
Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
149-175KQENKIDSPNKKKNKKDARNYNIKNGIHydrophilic
255-275VIEIKGIKQVKKKKKINYDELHydrophilic
NLS Segment(s)
PositionSequence
160-163KKNK
253-269KPVIEIKGIKQVKKKKK
Subcellular Location(s) nucl 15.5, cyto_nucl 12, cyto 7.5, mito 3
Family & Domain DBs
KEGG nce:NCER_101056  -  
Amino Acid Sequences MSEIFFLKVITESNKRFIIKADPESTINSLIDLIKRYFAHYYSLKYFIKYIYTPDKFAILDNMPIKYFFNTGDICYIKGNEQDGKLGFLEGLVTKISYDQIQNINKSVAVMKEGPTILSSQKTVKPLNAKNFCGENERLTNETNVLENKQENKIDSPNKKKNKKDARNYNIKNGINPNLIINDTNKHKIYSKGEFATKKISNVIESPLSKPIEVSNDTDNKINLTEENKQDLDLKEKNTLFILENINDKPKEKPVIEIKGIKQVKKKKKINYDEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.38
3 0.38
4 0.39
5 0.42
6 0.42
7 0.47
8 0.45
9 0.42
10 0.43
11 0.45
12 0.44
13 0.37
14 0.29
15 0.21
16 0.19
17 0.18
18 0.18
19 0.19
20 0.17
21 0.19
22 0.2
23 0.22
24 0.24
25 0.23
26 0.27
27 0.27
28 0.32
29 0.31
30 0.38
31 0.36
32 0.35
33 0.35
34 0.3
35 0.32
36 0.27
37 0.29
38 0.32
39 0.34
40 0.34
41 0.33
42 0.34
43 0.3
44 0.3
45 0.29
46 0.19
47 0.23
48 0.23
49 0.24
50 0.21
51 0.22
52 0.22
53 0.18
54 0.18
55 0.13
56 0.14
57 0.14
58 0.14
59 0.19
60 0.19
61 0.18
62 0.18
63 0.18
64 0.16
65 0.18
66 0.19
67 0.17
68 0.17
69 0.19
70 0.19
71 0.2
72 0.18
73 0.16
74 0.13
75 0.1
76 0.1
77 0.07
78 0.08
79 0.06
80 0.06
81 0.05
82 0.06
83 0.07
84 0.07
85 0.08
86 0.1
87 0.17
88 0.21
89 0.22
90 0.23
91 0.23
92 0.21
93 0.21
94 0.19
95 0.12
96 0.12
97 0.11
98 0.11
99 0.14
100 0.14
101 0.13
102 0.12
103 0.13
104 0.12
105 0.12
106 0.12
107 0.12
108 0.15
109 0.19
110 0.2
111 0.22
112 0.29
113 0.34
114 0.43
115 0.45
116 0.43
117 0.41
118 0.42
119 0.4
120 0.36
121 0.32
122 0.24
123 0.21
124 0.21
125 0.21
126 0.19
127 0.19
128 0.15
129 0.14
130 0.13
131 0.11
132 0.1
133 0.11
134 0.12
135 0.14
136 0.16
137 0.17
138 0.17
139 0.18
140 0.24
141 0.31
142 0.38
143 0.46
144 0.52
145 0.61
146 0.69
147 0.73
148 0.77
149 0.8
150 0.82
151 0.82
152 0.84
153 0.83
154 0.86
155 0.83
156 0.8
157 0.78
158 0.68
159 0.6
160 0.53
161 0.49
162 0.39
163 0.36
164 0.28
165 0.21
166 0.21
167 0.18
168 0.15
169 0.15
170 0.17
171 0.22
172 0.22
173 0.22
174 0.24
175 0.3
176 0.35
177 0.36
178 0.39
179 0.38
180 0.44
181 0.45
182 0.44
183 0.47
184 0.42
185 0.37
186 0.34
187 0.31
188 0.27
189 0.26
190 0.28
191 0.25
192 0.25
193 0.26
194 0.27
195 0.27
196 0.25
197 0.24
198 0.23
199 0.23
200 0.23
201 0.24
202 0.25
203 0.29
204 0.3
205 0.32
206 0.3
207 0.25
208 0.24
209 0.22
210 0.18
211 0.18
212 0.24
213 0.26
214 0.31
215 0.3
216 0.3
217 0.34
218 0.33
219 0.36
220 0.33
221 0.33
222 0.35
223 0.36
224 0.36
225 0.32
226 0.33
227 0.27
228 0.27
229 0.29
230 0.23
231 0.27
232 0.28
233 0.33
234 0.33
235 0.32
236 0.31
237 0.34
238 0.39
239 0.36
240 0.42
241 0.45
242 0.53
243 0.58
244 0.62
245 0.57
246 0.6
247 0.64
248 0.61
249 0.61
250 0.63
251 0.67
252 0.71
253 0.77
254 0.77
255 0.83