Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C4VC21

Protein Details
Accession C4VC21    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
112-137FKAILFVVKKCRSKKKVRFDGTDIIYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 11, cyto 4.5, mito 3, E.R. 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG nce:NCER_102462  -  
Amino Acid Sequences MLKIMVDQYLMDKENNKNDKEKFQLSFKPIEVKLRHKPKYFLKLNETPNCTRELQMLQPRGHDTNLIAQSSSQPADIKQSINEVSNSGTFQMSYFASLVCFMIVFLVLYCLFKAILFVVKKCRSKKKVRFDGTDIIYESI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.41
3 0.41
4 0.45
5 0.47
6 0.54
7 0.56
8 0.57
9 0.5
10 0.51
11 0.56
12 0.52
13 0.53
14 0.47
15 0.47
16 0.42
17 0.48
18 0.45
19 0.46
20 0.52
21 0.57
22 0.63
23 0.6
24 0.65
25 0.65
26 0.71
27 0.71
28 0.68
29 0.65
30 0.66
31 0.71
32 0.71
33 0.68
34 0.59
35 0.52
36 0.49
37 0.42
38 0.34
39 0.28
40 0.23
41 0.25
42 0.3
43 0.35
44 0.32
45 0.32
46 0.34
47 0.33
48 0.3
49 0.24
50 0.17
51 0.19
52 0.2
53 0.19
54 0.16
55 0.15
56 0.16
57 0.16
58 0.16
59 0.09
60 0.07
61 0.07
62 0.12
63 0.13
64 0.13
65 0.12
66 0.14
67 0.15
68 0.16
69 0.16
70 0.12
71 0.12
72 0.12
73 0.12
74 0.1
75 0.09
76 0.08
77 0.07
78 0.09
79 0.08
80 0.08
81 0.08
82 0.07
83 0.07
84 0.08
85 0.08
86 0.06
87 0.06
88 0.04
89 0.04
90 0.04
91 0.04
92 0.04
93 0.05
94 0.06
95 0.06
96 0.06
97 0.07
98 0.07
99 0.07
100 0.07
101 0.07
102 0.14
103 0.15
104 0.18
105 0.28
106 0.36
107 0.43
108 0.51
109 0.61
110 0.63
111 0.73
112 0.81
113 0.82
114 0.85
115 0.87
116 0.87
117 0.82
118 0.82
119 0.75
120 0.69