Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4V9N2

Protein Details
Accession C4V9N2    Localization Confidence High Confidence Score 17.6
NoLS Segment(s)
PositionSequenceProtein Nature
33-65EEEKYSKKKIRQLSKKSHKKKAKTCTNVKLENNHydrophilic
136-163KSKLEYPKVNEKEKNRFKPKAKKRIKKRBasic
NLS Segment(s)
PositionSequence
39-55KKKIRQLSKKSHKKKAK
88-163SRKERRMLKIKNNGKGLSSKEFMKVYKEGDGRKIVKEDRERSKLHIPSKSKLEYPKVNEKEKNRFKPKAKKRIKKR
Subcellular Location(s) nucl 21.5, cyto_nucl 13, mito 4
Family & Domain DBs
KEGG nce:NCER_101280  -  
Amino Acid Sequences MSNVTEKQLHKQSLTKVVDYLNEKNNNETENTEEEKYSKKKIRQLSKKSHKKKAKTCTNVKLENNNIIESTKSIAFNEKNANNEEKLSRKERRMLKIKNNGKGLSSKEFMKVYKEGDGRKIVKEDRERSKLHIPSKSKLEYPKVNEKEKNRFKPKAKKRIKKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.47
3 0.41
4 0.39
5 0.41
6 0.41
7 0.41
8 0.39
9 0.43
10 0.42
11 0.43
12 0.44
13 0.39
14 0.36
15 0.31
16 0.27
17 0.25
18 0.28
19 0.25
20 0.24
21 0.24
22 0.3
23 0.32
24 0.37
25 0.39
26 0.42
27 0.48
28 0.57
29 0.67
30 0.7
31 0.77
32 0.8
33 0.83
34 0.88
35 0.9
36 0.91
37 0.89
38 0.88
39 0.88
40 0.87
41 0.87
42 0.85
43 0.85
44 0.84
45 0.83
46 0.81
47 0.74
48 0.71
49 0.62
50 0.59
51 0.51
52 0.41
53 0.34
54 0.26
55 0.23
56 0.16
57 0.16
58 0.1
59 0.09
60 0.09
61 0.14
62 0.14
63 0.16
64 0.22
65 0.22
66 0.23
67 0.24
68 0.26
69 0.22
70 0.23
71 0.22
72 0.2
73 0.22
74 0.27
75 0.3
76 0.31
77 0.38
78 0.44
79 0.51
80 0.57
81 0.61
82 0.64
83 0.7
84 0.74
85 0.74
86 0.71
87 0.63
88 0.54
89 0.5
90 0.44
91 0.39
92 0.34
93 0.28
94 0.26
95 0.28
96 0.27
97 0.27
98 0.25
99 0.22
100 0.27
101 0.3
102 0.28
103 0.31
104 0.38
105 0.36
106 0.37
107 0.4
108 0.36
109 0.41
110 0.48
111 0.51
112 0.53
113 0.57
114 0.56
115 0.57
116 0.63
117 0.62
118 0.6
119 0.61
120 0.57
121 0.56
122 0.62
123 0.6
124 0.56
125 0.56
126 0.57
127 0.57
128 0.59
129 0.64
130 0.63
131 0.68
132 0.71
133 0.72
134 0.75
135 0.77
136 0.81
137 0.8
138 0.83
139 0.84
140 0.88
141 0.91
142 0.91
143 0.91