Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C4V832

Protein Details
Accession C4V832    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
62-81CVPSWRFYRKNPLKFEKKNNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, E.R. 5, plas 2, cyto 1, pero 1, golg 1, cyto_pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR009542  Spc1/SPCS1  
Gene Ontology GO:0005787  C:signal peptidase complex  
GO:0006465  P:signal peptide processing  
KEGG nce:NCER_100634  -  
Pfam View protein in Pfam  
PF06645  SPC12  
Amino Acid Sequences MNIFEKFNPPIDYHGQELSMKLFYVLIYIGYFFSLITGILYNDLKYTLLLGIFTVCIVFFICVPSWRFYRKNPLKFEKKNN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.27
3 0.25
4 0.25
5 0.22
6 0.16
7 0.14
8 0.11
9 0.1
10 0.08
11 0.08
12 0.07
13 0.06
14 0.05
15 0.06
16 0.06
17 0.05
18 0.06
19 0.05
20 0.05
21 0.04
22 0.04
23 0.04
24 0.04
25 0.04
26 0.05
27 0.06
28 0.06
29 0.06
30 0.06
31 0.06
32 0.05
33 0.06
34 0.05
35 0.05
36 0.05
37 0.05
38 0.05
39 0.05
40 0.05
41 0.04
42 0.03
43 0.04
44 0.04
45 0.05
46 0.04
47 0.07
48 0.08
49 0.11
50 0.14
51 0.17
52 0.2
53 0.27
54 0.3
55 0.34
56 0.44
57 0.51
58 0.58
59 0.65
60 0.72
61 0.77