Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C4V8Q6

Protein Details
Accession C4V8Q6    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
119-146ITSRLNRCIKHYKKKLRIPTTWKPKLVEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 8, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR012606  Ribosomal_S13/S15_N  
IPR000589  Ribosomal_S15  
IPR023029  Ribosomal_S15P  
IPR009068  S15_NS1_RNA-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG nce:NCER_100891  -  
Pfam View protein in Pfam  
PF08069  Ribosomal_S13_N  
PF00312  Ribosomal_S15  
Amino Acid Sequences MAKMHSSGRGISTSIKPFTVMFPTWLDVPVEEIKADVLKMNTKGVSSAEIGNKLRDVYGVGDCKTIFNGLSLSRYLEKEGNFIEIPEDVKDLVKRANILRKHINIHRRDKDSKFRLGLITSRLNRCIKHYKKKLRIPTTWKPKLVELVK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.3
3 0.28
4 0.27
5 0.29
6 0.29
7 0.24
8 0.2
9 0.21
10 0.22
11 0.22
12 0.22
13 0.19
14 0.14
15 0.17
16 0.16
17 0.15
18 0.13
19 0.12
20 0.12
21 0.12
22 0.12
23 0.1
24 0.09
25 0.13
26 0.14
27 0.16
28 0.16
29 0.16
30 0.17
31 0.15
32 0.16
33 0.13
34 0.16
35 0.16
36 0.2
37 0.21
38 0.21
39 0.2
40 0.18
41 0.17
42 0.13
43 0.12
44 0.1
45 0.13
46 0.15
47 0.15
48 0.16
49 0.16
50 0.16
51 0.15
52 0.13
53 0.09
54 0.07
55 0.08
56 0.07
57 0.08
58 0.08
59 0.1
60 0.11
61 0.11
62 0.12
63 0.13
64 0.13
65 0.13
66 0.14
67 0.15
68 0.13
69 0.13
70 0.12
71 0.1
72 0.11
73 0.09
74 0.09
75 0.07
76 0.08
77 0.08
78 0.09
79 0.1
80 0.11
81 0.13
82 0.16
83 0.24
84 0.26
85 0.32
86 0.38
87 0.39
88 0.44
89 0.49
90 0.53
91 0.54
92 0.61
93 0.64
94 0.64
95 0.67
96 0.68
97 0.72
98 0.69
99 0.68
100 0.6
101 0.55
102 0.5
103 0.45
104 0.42
105 0.37
106 0.4
107 0.38
108 0.39
109 0.43
110 0.43
111 0.42
112 0.46
113 0.51
114 0.52
115 0.58
116 0.66
117 0.71
118 0.78
119 0.87
120 0.91
121 0.9
122 0.9
123 0.88
124 0.88
125 0.88
126 0.87
127 0.82
128 0.74
129 0.68